@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B4WZ99_9GAMM: (2019-01-26 )
MSQVDTLDTQKLAEYLEQHIDGFKGPIEADKFEGGQSNPTFKITAASGAYVLRRQPPGKLLKSAHAVDREFRVMAALKDTDVPVPNVLHLCEDRDVIGSMFYVMEFCEGRILWSAGLPEMGEGEAANAVRGEMYSEMNRVLAAMHSVDLEAVGLTDYGKPGNYFERQLGRWTQQYEASKLQEIPAMDSLIEWLQANQPEDDGQVSLVHGDYRLDNMMWHPEKPQVIAVLDWELSTLGHPLADLAYQCMGMRMPQRGAKMAGLQGKDRTALGIPTEKEYVAMYCERRGISQIDNWEFYLAFSFFRLAAICQGVAKRAEDGNASNKQAAEVGALVEPLATMAMQIINEGA

Atome Classification :

(21 SA) --------------........-.10....-....20.-----.-----......30-.......-..40.....---------..--------.---------50-.....-...60--.--....-.-..70..-......-80--.-.....-...90..---..--------....100---..-......-110......--------..-120.---......---130......-.140..-.....150--------.----.......----160---.......---..170-.......-.-------.180------.-------..---------------....-..190......---..200.-.--..-.....210....-...220-.......230.......-240.....-..250.......260.......270.---......280.......-----------290..-----.....300........310.-....-..320--.......-330...-..-..340......---
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) --------------MSQVDTLD-TQKLAEY-LEQHIDG-----F-----KGPIEAD--KFEGGQS-NPTFKITAA---------SG--------A---------YV-LRRQP-PGKLL--K--SAHA-V-DREFRV-MAALKD-T---D-VPVPN-VLHLCED---RD--------VIGSMF----YV-MEFCEG-R-ILWSAGL--------PE-MGEG---EAANAV---RGEMYSEMN-RVLAAM-HSVDLEA---------V----GLTDYGK----P-----GNYFERQ---LGR---WTQQYEA-S-------KL--------Q-------EI---------------PAMD-SLI-EWLQANQ---PED--D-G--QV-SLVHGDYRLDNM-MWHPEK-PQVIAVLDWELSTLGHP-LADLAYQC-MGMRMPQRGAKMAGLQGKDRTALGIP---TEKEYVAMYCERRGIS-----------QIDNW-----EFYLAFS-FFRLAAICQGVA-KRAE-DGNAS--NKQAAEV-GALVEP-LA-TMAMQIINEGA---
36 HHSearch 93.3852% -94 - C3 - - 3DXP ? A:[20-354] -------------------RFD-TEALEAW-MRQHVEG-----F-----AGPLSVE--QFKG-QS-NPTFKLVTP---------GQ--------T---------YV-MRAKP-G------------A-I-EREYRV-MDALAG-T---D-VPVAK-MYALCED---ES--------VIGRAF----YI-MEFVSG-R-VLWDQSL--------PG-MSPA--------E---RTAIYDEMN-RVIAAM-HTVDYQA---------I----GLGDYGK----P-----GNYFQRQ---IER---WTKQYKL-S-------ET--------E-------SI---------------PAMD-SLM-DWLPQHI---PQED-A-D--LT-SIVHGDYRLDNL-MFHPTE-PRVLAVLDWELSTLGHP-MGDFGYHC-MSWHIAPGQFR--GIAGLDHAALGIP---DEASYRKLYEQRTGRP-----------ITGDW-----NFYLAFS-MFRIAGILQGIM-KRVV-DGTAS--SAQALDA-GKRARP-MA-EMGWEYA-------
1 PsiBlast_PDB 82.8950% -22 - C3 - - 3DXP ? A:[21-347] --------------------FD-TEALEAW-MRQHVEG-----F-----AGPLSVE--QFKG-QS-NPTFKLVTP---------GQ--------T---------YV-MRAKPG-------------A-I-EREYRV-MDALAG-T---D-VPVAK-MYALCED---ES--------VIGRAF----YI-MEFVSG-R-VLWDQSL--------PG-MSPA---E--------RTAIYDEMN-RVIAAM-HTVDYQA---------I----GLGDYGK----P-----GNYFQRQ---IER---WTKQYKL-S-------ET--------E-------SI---------------PAMD-SLM-DWLPQHI---PQE--D-A--DLTSIVHGDYRLDNL-MFHPTE-PRVLAVLDWELSTLGHP-MGDFGYHC-MSWHIAP--GQFRGIAGLDHAALGIP---DEASYRKLYEQRTGRP-----------ITGDW-----NFYLAFS-MFRIAGILQGIM-KRVV-DGTAS--SAQALDA-GKRARP-MA---------------
22 Fugue 68.1246% 14 - C3 - - 3DXP ? A:[20-359] -------------------RFD-TEALEAWMR-QHVEG-----F-----AGPLSVE--QF-KGQS-NPTFKLVTP---------GQ--------T---------YVMRAK--------------PGA-I-EREYRVMDA-LAG-T---D-VPVAKMY-ALCED---ES--------VIGRAF----YIMEFV-SG-R-VLWDQSL--------PGMSPAE---RTAIYD-----------EMNRVIAAMHTVDYQA---------I----GLGDYGK----P-----GNYFQRQ---IER---WTKQYKL-S-------ET--------E-------SI---------------P--AMDSLMDWLPQHI---PQE--DAD--LT-SIVHGDYRLDNLMF-HPTE-PRVLAVLDWELSTLGHPMG-DFGYHCMSWHIAPGQFR---GIAGLDHAALGIP---DEASYRKLYEQRTGRP-----------ITGDW-----NFYLAFSMF-RIAGILQGI-MKRVV-DGTAS--SAQALDA-GKRARPMAEMGWEYAKKAKQ----
38 HHSearch 55.9024% -26 - C3 - - 3ATS Y3168_MYCTU A:[4-328] ------------------------AVISRW-LSSVLPG-----GA----APEVTVESGVDSTGMS-SETIILTARWQQDGRSI-QQ--------K---------LV-ARVAP-AAEDVPVF--PTYR-L-DHQFEV-IRLVGELT---D-VPVPR-VRWIETT---GD--------VLGTPF----FL-MDYVEG-V-VPPDVMPYTFGDNWFAD-APAE--------R---QRQLQDATV-AALATL-HSIPNAQ---------N----TFSFLT-----------DTTLHRHFNWVRS---WYDFAVE-G--------I--------G-------RS---------------PLLE-RTF-EWLQSHW---PDDAAA-R--EP-VLLWGDARVGNV-LYRDF---QPVAVLDWEMVALGPR-ELDVAWMI-FAHRVFQELAG-------LATLPGLPEVMREDDVRATYQALTGVE------------LGDL-----HWFYVYS-GVMWACVFMRTG-ARRV----------------------------------------
21 Fugue 55.7122% -8 * C3 * - 3ATS Y3168_MYCTU A:[1-357] --------------------TL-PAVISRW-LSSVLPG-----GAAP--EVTVESG--VDSTGMS-SETIILTAR---------WQQDGRSIQQK---------LV-ARVAP-AAEDV--PVFPTYR-L-DHQFEV-IRLVGELT---D-VPVPR-VRWIETT---GD--------VLGTPF----FL-MDYVEG-V-VPPDVMP--------YT-FGDNWFADAPAER---QRQLQDATV-AALATL-HSIPNAQ---------N----TFSFLT------------DTTLHR---HFN---WVRSWYD-F-------AV--------E-------GIGRS------------PLLE-RTF-EWLQSHW---PDD--A-AAREP-VLLWGDARVGNV-LYRD---FQPVAVLDWEMVALGPR-ELDVAWMI-FAHRVFQELAGLATLPGL----PEVM---REDDVRATYQALTG-V-----------ELGDL-----HWFYVYS-GVMWACVFMRTG-ARRVHFGEIE--KPDDVESLFYHAGL-MK-HLLGEEH-------
37 HHSearch 55.6724% -22 - C3 - - 3ATT Y3168_MYCTU A:[4-328] ------------------------AVISRW-LSSVLPG-----GA----APEVTVESGVDSTGMS-SETIILTARWQQDGRSI-QQ--------K---------LV-ARVAP-AAEDVPVF--PTYR-L-DHQFEV-IRLVGELT---D-VPVPR-VRWIETT---GD--------VLGTPF----FL-MDYVEG-V-VPPDVMPYTFGDNWFAD-APAE--------R---QRQLQDATV-AALATL-HSIPNAQ---------N----TFSFLT-----------DTTLHRHFNWVRS---WYDFAVE-G--------I--------G-------RS---------------PLLE-RTF-EWLQSHW---PDDAAA-R--EP-VLLWGDARVGNV-LYRDF---QPVAVLDWEMVALGPR-ELDVAWMI-FAHRVFQELAG-------LATLPGLPEVMREDDVRATYQALTGVE------------LGDL-----HWFYVYS-GVMWACVFMRTG-ARRV----------------------------------------
2 PsiBlast_PDB 50.8425% -31 - C3 - - 3ATS Y3168_MYCTU A:[71-340] ----------------------------------------------------------------------------------------------------------------------------TYR-L-DHQFEV-IRLVGELT---D-VPVPR-VRWIETT---GD--------VLGTPF----FL-MDYVEG-V-VPPDVMP--------YT-FGDN---WFADAPAERQRQLQDATV-AALATL-HSIP-NA---------Q----NTFSFLT--------------DTT---LHRHFNWVRSWYD-F-------AV--------E-------GIGRS------------PLLE-RTF-EWLQSHW---PDD--A-AAREP-VLLWGDARVGNV-LYRDFQ-P--VAVLDWEMVALGPR-ELDVAWMI-FAHRVFQELAGLATLPGLPE----VM---REDDVRATYQALTGVE-----------LGDLH-----WFYVYSG-VMWACVFMRTGA-RRVH-FGEIE--KPDDVE--------------------------
3 PsiBlast_PDB 50.5825% -30 - C3 - - 3ATT Y3168_MYCTU A:[71-340] ----------------------------------------------------------------------------------------------------------------------------TYR-L-DHQFEV-IRLVGELT---D-VPVPR-VRWIETT---GD--------VLGTPF----FL-MDYVEG-V-VPPDVMP--------YT-FGDN---WFADAPAERQRQLQDATV-AALATL-HSIP-NA---------Q----NTFSFLT--------------DTT---LHRHFNWVRSWYD-F-------AV--------E-------GIGRS------------PLLE-RTF-EWLQSHW---PDD--A-AAREP-VLLWGDARVGNV-LYRDFQ-P--VAVLDWEMVALGPR-ELDVAWMI-FAHRVFQELAGLATLPGLPE----VM---REDDVRATYQALTGVE-----------LGDLH-----WFYVYSG-VMWACVFMRTGA-RRVH-FGEIE--KPDDVE--------------------------
59 SP3 45.3913% 19 - C3 - - 1NW1 - CKA2_CAEEL A:[32-426] GMKELLSTMDLDTDANTIPEL--KERAHML-CARFLGGAWKTVP-----LEHLRIS--RIKGGMS-NMLFLCRLS---------EV--------YPPIRNEPNKVL-LRVYF-NPE-------TESH-L-VAESVI-FTLLSE-R---H-L-GPK-LYGIFSG------------------G----RL-EEYIPS-R-PLSCHEI--------SL------------------AHMSTKIA-KRVAKV-HQLE-------------------VPIWK----E-----PDYLCEA---LQR---WLKQLTG-T-------VD--------A-------EHRFDLPEECGVSSVNCLDLA-REL-EFLRAHI---SLS--K-S--PV-TFCHNDLQEGNI-LLPKR-----LVLIDFEYASYNYR-AFDFANHF-IEWTIDYDIDEAPFYKIQTENFPEND---QMLEFFLNYLREQGNT-----------RENELYKKSEDLVQETL-PFVPVSHFFWGV-WGLL-QVELSPVGFGFADY-GRDRLS-LY-FKHKQLLKNLA---
25 Fugue 44.4817% -36 - C3 - - 1J7L KKA3_ENTFL A:[2-264] ---------------------A-KMRISPE-LKKLIEK-----Y---------RCV--KDTEGMS-PAKVYKLVG---------EN--------E---------NL-YLKMT-DSRYK--G--TTYD-V-EREKDM-MLWLEG-K-----LPVPK-VLHFERH---D-----------GWSN----LL-MSEADG-V-LCSEEYE--------DE-QS--------------PEKIIELYA-ECIRLF-HSIDISD---------CPYTNSLDSRLA----E-----LDYLLNN---DLA---DVDCENW-E-------ED--------T-------PF---------------KDPR-ELY-DFLKTEK---PEE--E-----L-VFSHGDLGDSNI-FVK--D-GKVSGFIDLGRSGRADK-WYDIAFCV-RSIRED-------------------I---GEEQYVELFFDLLGIK---------------------------------------------------P--DWEKIKY-YILLDE-LF---------------
45 HHSearch 44.2818% -22 - C3 - - 6EF6 ? A:[27-313] -----------------------DVTIAQQ-ALTHYDV-----S------DNASLR--LL-NLSE-NATYLVEDG---------EH--------Q---------SI-LRVHR-QDYH------QPHE-I-ESELDW-LAALRTDS---D-VTVPT-VVPARDG---RRVVTVDPAD-VPRHV----VH-FEMVGG-A-EPDEES------------LTL---------------DDFQTLG-RITASL-HEHSQRW---------T----RPAGFGRFSWDW-----EHCL-GD---TPR---WGRWQDA-EGV-----GA--------S-------ET---------------ALLT-RAQ-DLLHRKLEEYGSG--P-D--RY-GLIHADLRLANL-LVDSSTPQRTITVIDFDDCGFGWY-FYDFGTAV-SFIEHDP---------------RLGE---WQESWVAGYRSRRELP------------AADE-----AMLPSFV-FLRRLL---------------------------------------------------
42 HHSearch 42.5119% -44 - C3 - - 5IGI ? A:[2-258] ---------------TVVTTAD-TSQLYAL-AAR-HGL-----K------LHGPLT--VNELGLD-YRIVIATVDD--------GR--------R---------WV-LRIPR-RAE-------VSAK-V-EPEARV-LAMLKNRL---P-FAVPD-WRVANAE-------------LVAYPMLEDSTA--VIQPG-S-STPDWV-------------VPQ--------D---SEVFAESFA-TALAAL-HAVPISA---------A----VDAGMLIRT--PTQA--RQKVADD---VDR---VRREFV--------------------V-------ND---------------KRLH-RWQ-RWLDDDS---SW---P-D--FS-VVVHGDLYVGHV-LIDNT--ERVSGMIDWSEARVDDP-AIDMAAHL-MVFG--------------------EE---GLAKLLLTYEAAGGRV--------------------------------------------------------------------------------------
43 HHSearch 42.2217% -72 - C3 - - 2PPQ - KHSE_AGRFC A:[5-258] ------------------TDIT-EDELRNF-LTQ-YDV-----G------SLTSYK--GIAE----NSNFLLHTT---------KD--------P---------LI-LTLYE-K----------KND-L-PFFLGL-MQHLAA-K---G-LSCPL-PLPRKDG---ELLGE-----LSGRPA----AL-ISFLEG-M-WLRKP--------------EA---------------KHCREVG-KALAAM-HLASEGF---------E----IKRP-NA-----------L----S---VDG---WKVLWDK-SEERADEVEK--------G-------LR---------------EEIR-PEI-DYLAAHW---PK---D-L--PA-GVIHADLFQDNV-FFLGD---ELSGLIDFYFACNDLL-AYDVSICL-NAWCFEKD------------GAYNVT---KGKALLEGYQSVRPLS--------------------------------------------------------------------------------------
28 Fugue 42.1812% -17 - C3 - - 2PPQ - KHSE_AGRFC A:[5-320] ------------------TDIT-EDELRNF-LTQY---------------DVGSLT--SYKGIAE-NSNFLLHTT---------KD--------P---------LI-LTLYE-KKNDL--P--FFLG-LMQ--------HLAA-K---G-LSCPL-PLPRKDGELLGE--------LSGRPA----AL-ISFLEGMW----------------------------LRKP---EAKHCREVG-KALA-AMHLASEGF---------E----IKRPNAL----S-----VDGWKVL---WDK---SEERADE-V-------EK--------G-------LR---------------EEIR-PEI-DYLAAHW---PKD--L-P--A--GVIHADLFQDNV-FFL--G-DELSGLIDFYFACNDLL-AYDVSICL-NAWCFEKDGA------------YNVT---KGKALLEGYQSVRPLS-----------EAELE-----ALPLLSR-GSALRFFLTRLY-DWLT-TPAGA--LVVKKDP-LEYLRK-LR-FHRTIANVAEYGLA
48 HHSearch 41.9514% -22 - C3 - - 1NW1 - CKA2_CAEEL B:[54-394] ------------------------ERAHML-CARFLGG-----AWKTVPLEHLRIS--RIKGGMS-NMLFLCRLSEVYPPIRNEPN--------K---------VL-LRVYF-NPE-------TESH-L-VAESVI-FTLLSE-R---H-LG-PK-LYGIFS------------------GG----RL-EEYIPS-R-PLSCHEI-----------------------S---LAHMSTKIA-KRVAKV-HQLEVPI---------W----KEPD---------------YLCEA---LQR---WLKQLTG-T-------VDAEHRFDLPEECGVSSVNC---------------LDLA-REL-EFLRAHI---SLS--K-S--PV-TFCHNDLQEGNI-LLPK-----RLVLIDFEYASYNYR-AFDFANHF-IEWTIDYDIDEAPFYKIQTENFPEND---QMLEFFLNYLREQGNTRENELYKKSEDLVQET-----LPFVPVS-HFFWGVWGLLQ----------------------------------------------
49 HHSearch 41.6214% -20 - C3 - - 1NW1 - CKA2_CAEEL A:[54-394] ------------------------ERAHML-CARFLGG-----AWKTVPLEHLRIS--RIKGGMS-NMLFLCRLSEVYPPIRNEPN--------K---------VL-LRVYF-NPE-------TESH-L-VAESVI-FTLLSE-R---H-LG-PK-LYGIFS------------------GG----RL-EEYIPS-R-PLSCHEI-----------------------S---LAHMSTKIA-KRVAKV-HQLEVPI---------W----KEPD---------------YLCEA---LQR---WLKQLTG-T-------VDAEHRFDLPEECGVSSVNC---------------LDLA-REL-EFLRAHI---SLS--K-S--PV-TFCHNDLQEGNI-LLPK-----RLVLIDFEYASYNYR-AFDFANHF-IEWTIDYDIDEAPFYKIQTENFPEND---QMLEFFLNYLREQGNTRENELYKKSEDLVQET-----LPFVPVS-HFFWGVWGLLQ----------------------------------------------
47 HHSearch 41.2015% -19 - C3 - - 5IQI AACA_STAAU C:[9-257] -------------------ATN-VKAMKYL-IEHYFDN-----F------KVDSIE--IIGSGYD-SVAYLVN------------N--------E---------YI-FKTKF-STN-------KKKG-F-AKEKAI-YNFLNT-NLETN-VKIPN-IEYSYIS--------------DELSI----LG-YKEIKG-T-FLTPEIY--------ST-MSEE--------E---QNLLKRDIA-SFLRQM-HGLDYTD---------I----SECTIDN----K-----QNVLEEY---ILL---RETIYND-L-------TD--------I-------EK---------------DYIE-SFM-ERLNATT---VF---E-G--KK-CLCHNDFSCNHL-LLDGN--NRLTGIIDFGDSGIIDE-YCDFIYLL-EDSEEE----------------IGTN---FGEDILRMYGN-------------------------------------------------------------------------------------------
34 Fugue 40.7813% 2 - C3 - - 3JR1 ? A:[14-309] ----------------NLYFQGMWKSISQV-LAEQF-G-----A-----YYFIKHK--EKLYSGEMNEIWLINDE---------VQ--------T---------VF-VKINE--------R--SYRSMF-RAEADQ-LALLAK-T---NSINVPL-VYGIGNS---QG-----------HSF----LL-LEALN-------------------------------KSKN---KQSSFTIFA-EKIAQL-HQIQGPDKYGLDFDTWL----GPIYQPN----DWQTSWAKFFSEN---RIG---WQLQICK-E-------KG--------L-------IF---------------GNID-LIV-QIVADTL---SKH--N-P--KP-SILHGNLWIENC-IQVDDK-IFVCNPACY----WGDR-ECDIAFSS-LFEPFP-------------------------TNFYQRYNEIYPLEEG---------YLERK-----LIYQLYY-LLNFSYRY-----------YNKK--QSYVSLT-QKLINQ-IL-HK------------
55 HHSearch 40.0215% -16 - C3 - - 5IQC AACA_STAAU A:[8-257] ------------------NATN-VKAMKYL-IEHYFDN-----F------KVDSIE--IIGSGYD-SVAYLV------------NN--------E---------YI-FKTKF-STN-------KKKG-Y-AKEKAI-YNFLNT-NLETN-VKIPN-IEYSYIS--------------DELSI----LG-YKEIKG-T-FLTPEIY--------ST-MSEE--------E---QNLLKRDIA-SFLRQM-HGLDYTD---------I----SECTIDN----K-----QNVLEE----YIL---LRETIYNDL-------TD--------I-------EK---------------DYIE-SFM-ERLNATT---V-F--E-G--KK-CLCHNDFSCNHL-LLDGN--NRLTGIIDFGDSGIIDE-YCDFIYLL-EDSEEE----------------IGTN---FGEDILRMYGN-------------------------------------------------------------------------------------------
51 HHSearch 39.9116% -36 - C3 - - 4R7B - ? A:[22-275] -----------------------EKIIKEK-ISSLLSQ-----E-----EEVLSVE--QL-GGMT-NQNYLAKTT---------NK--------Q---------YI-VKFFG-KGTE------KLIN-R-QDEKYN-LELLKD-L---G-LDVKN-YLFDIE-----------------AGI----KV-NEYIES-AITLDST-------------------------S---IKTKFDKIA-PILQTI-HTSAKEL---------R----GE--FAP----F----------EE---IKK---YESLIEE-Q-------IPY-------A-------NY---------------ESVR-NAV-FSLEKRL---ADL--G-V--DR-KSCHIDLVPENF-IESPQ--GR-LYLIDWEYSSMNDP-MWDLAALF-LESEFT------------------SQ---EEETFLSHYESDQTPV-----------SHEKI-----AIYKILQ-DTIWSLWT-------------------------------------------------
50 HHSearch 39.6616% -31 - C3 - - 4R78 ? A:[22-275] -----------------------EKIIKEK-ISSLLSQ-----E-----EEVLSVE--QL-GGMT-NQNYLAKTT---------NK--------Q---------YI-VKFFG-KGTE------KLIN-R-QDEKYN-LELLKD-L---G-LDVKN-YLFDIE-----------------AGI----KV-NEYIES-AITLDST-------------------------S---IKTKFDKIA-PILQTI-HTSAKEL---------R----GE--FAP----F----------EE---IKK---YESLIEE-Q-------IPY-------A-------NY---------------ESVR-NAV-FSLEKRL---ADL--G-V--DR-KSCHIDLVPENF-IESPQ--GR-LYLIDWEYSSMNDP-MWDLAALF-LESEFT------------------SQ---EEETFLSHYESDQTPV-----------SHEKI-----AIYKILQ-DTIWSLWT-------------------------------------------------