@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMG9: (2017-11-08 )
MSELKQDQYWMQQAIELAKRGLYSTKPNPNVGCVIVKDNQVIGEGFHPRAGQPHAEVFALRQAGEQAQGATAYVTLEPCAHYGRTPPCAEALVKAQVKKVVVACPDPNPLVAGKGVQILKNAGIEVEIGICEDLAAQLNQGFLKAMSSGMPYVRLKVASSLDGRTAMASGESKWITGSAARQDVQHWRAISGAVITGIETVIADDCQLNVRPLHNVDIETVAQPKRVILDRRGRLPLTAKILENPETVMVMGPYRQELADLGVIQLEIQPLKTLLQTLSKQYQIYDVLIEAGATLSSAFLQEGLIDEMISYVAPTLLGQSARAMFNADFEYMAQQLRFKLLDVTQLDQDIRLRLIPTQEKV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

5GP_A_5(3ZPG)
?
[Raw transfer]




GOL_A_6(2HXV)
?
[Raw transfer]




GOL_A_6(2HXV)
?
[Raw transfer]




GOL_A_8(2HXV)
?
[Raw transfer]




48 HHSearch 92.5798%-108 - C3 -3ZPG 4.0 ?
49 HHSearch 92.4298%-111 - C3 -3ZPC - ? -
2 PsiBlast_PDB 92.3597%-108 - C3 -3ZPG - ? -
1 PsiBlast_PDB 92.2097%-111 - C3 -3ZPC - ? -
51 HHSearch 68.3842% -65 - C3 -4G3M - RIBD_BACSU -
6 PsiBlast_PDB 67.7942% -64 - C3 -4G3M - RIBD_BACSU -
52 HHSearch 67.6842% -61 - C3 -2B3Z - RIBD_BACSU -
30 PsiBlast_CBE 67.6142% -64 - C3 -2D5N - RIBD_BACSU -
73 Fugue 67.5142% -59 - C3 -2B3Z - RIBD_BACSU -
26 PsiBlast_CBE 67.5042% -65 - C3 -3EX8 - RIBD_BACSU -
3 PsiBlast_PDB 67.3442% -60 - C3 -2B3Z - RIBD_BACSU -
22 PsiBlast_CBE 67.2942% -60 - C3 -4G3M - RIBD_BACSU -
23 PsiBlast_CBE 66.8242% -64 - C3 -4G3M - RIBD_BACSU -
5 PsiBlast_PDB 66.5042% -61 - C3 -3EX8 - RIBD_BACSU -
4 PsiBlast_PDB 65.9742% -62 - C3 -2D5N - RIBD_BACSU -
24 PsiBlast_CBE 65.4242% -58 - C3 -4G3M - RIBD_BACSU -
54 HHSearch 56.6137% -8 * C3 *2HXV 2.3 ?
7 PsiBlast_PDB 54.1335% -3 - C3 -2HXV 3.2 ?
62 HHSearch 43.8631% -59 - C3 -2B3J - TADA_STAAM -
11 PsiBlast_PDB 43.6229% -61 - C3 -2B3J - TADA_STAAM -