@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VTP3: (2017-12-14 )
MAFRNNVPQASWRLAKIALGGIVLTGLAVGTYAYAQQKPLPTVDKVELDRYLGVWYEVARKPAFFQKKCAYNVSATYTLNENGNIVVDNRCYDNQKQLQQSISEAFVVNPPYNTKLKVSFLPEAVRWIPIIRGDYWILKLDEDYQTVLVGEPSRKYLWVLSRTPHPHKEVVDEYLNYAKTLGFDIRDIIHTEYKE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

VCA_C_3(2ACO)
BLC_ECOLI
[Raw transfer]




3 PsiBlast_PDB 84.5636% -44 - C1 -1QWD - BLC_ECOLI -
2 PsiBlast_PDB 83.8936% -45 - C1 -2ACO - BLC_ECOLI -
21 PsiBlast_CBE 82.0036% -43 - C1 -2ACO 4.5 BLC_ECOLI
1 PsiBlast_PDB 78.0337% - - C1 -3MBT - BLC_ECOLI -
63 HHSearch 77.5934% -41 * C1 *1QWD - BLC_ECOLI -
72 HHSearch 76.2934% - - C1 -3MBT - BLC_ECOLI -
64 HHSearch 75.7134% 28 - C1 -2ACO - BLC_ECOLI -
65 HHSearch 72.7027% -43 - C1 -2HZQ - APOD_HUMAN -
66 HHSearch 70.9727% -43 - C1 -2HZR - APOD_HUMAN -
6 PsiBlast_PDB 70.5028% 6 - C1 -5F6Z - ? -
4 PsiBlast_PDB 69.5428% 8 - C1 -5EZ2 - ? -
5 PsiBlast_PDB 68.4128% 5 - C1 -5F1E - ? -
7 PsiBlast_PDB 66.2627% 6 - C1 -2HZQ - APOD_HUMAN -
8 PsiBlast_PDB 66.2527% 12 - C1 -2HZR - APOD_HUMAN -
69 HHSearch 61.5918% -43 - C1 -3EBW - ? -
77 HHSearch 59.1715% -19 - C1 -1Z24 - ICYA_MANSE -
67 HHSearch 56.9419% -31 - C1 -1BBP - BBP_PIEBR -
76 HHSearch 55.2920% 0 - C- -1KXO - BBP_PIEBR -
71 HHSearch 53.0214% 22 - C1 -1I4U - CRC1_HOMGA -
73 HHSearch 52.5813% -24 - C1 -1GKA - CRA2_HOMGA -