@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B4E3H3_HUMAN: (2017-06-01 )
WFHKKVEKRTSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHY

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

1 PsiBlast_PDB 93.4591%-150 - C2 -2DX0 - PLCG2_MOUSE -
4 PsiBlast_PDB 73.7863% -7 - C2 -3GQI - ? -
265 HHSearch 72.2141%-181 - C- -3EAZ - CSK_HUMAN -
3 PsiBlast_PDB 71.4563% - - C2 -4FBN - PLCG1_HUMAN -
14 PsiBlast_PDB 70.8839%-193 - C- -3EAZ - CSK_HUMAN -
2 PsiBlast_PDB 70.8163% -10 - C- -4EY0 - PLCG1_HUMAN -
26 PsiBlast_CBE 70.1437%-131 - C2 -1AYA - PTN11_MOUSE -
27 PsiBlast_CBE 69.8037%-143 - C2 -1AYA - PTN11_MOUSE -
48 PsiBlast_CBE 69.1934%-161 - C2 -4K45 - PLCG1_RAT -
13 PsiBlast_PDB 68.9436%-157 - C2 -3K2M - ABL1_HUMAN -
24 PsiBlast_CBE 68.8637%-139 - C2 -1AYC - PTN11_MOUSE -
29 PsiBlast_CBE 68.5237%-142 - C2 -3TL0 - PTN11_HUMAN -
8 PsiBlast_PDB 68.3336%-152 - C2 -3UYO - -
264 HHSearch 68.3237%-169 - C2 -2EO3 - CRKL_HUMAN -
15 PsiBlast_PDB 68.2336%-152 - C2 -2ABL - ABL1_HUMAN -
28 PsiBlast_CBE 68.1439%-137 - C2 -4H1O - PTN11_HUMAN -
37 PsiBlast_CBE 67.7537%-135 - C2 -4H34 - PTN11_HUMAN -
30 PsiBlast_CBE 67.6437%-136 - C2 -3TKZ - PTN11_HUMAN -
9 PsiBlast_PDB 67.4736%-161 - C2 -5DC4 - -
272 HHSearch 67.4237%-156 - C2 -3WA4 - GRB2_HUMAN -
252 PsiBlast_CBE 57.3634% -16 - C2 -1A07 4.2 SRC_HUMAN
247 PsiBlast_CBE 56.6634% -9 - C2 -1A09 3.5
246 PsiBlast_CBE 56.6134% -15 - C2 -1A1B 4.9 SRC_HUMAN
249 PsiBlast_CBE 55.8234% -15 - C2 -1A08 5.1
251 PsiBlast_CBE 55.6934% -10 - C2 -1A07 2.8
250 PsiBlast_CBE 54.5334% -14 - C2 -1A08 4.9 SRC_HUMAN