@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B5BU52_HUMAN: (2017-06-01 )
WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVGCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




ACE_B_3(1LKL)
?
[Raw transfer]




4 PsiBlast_PDB 94.6297%-219 - C3 -2RSY - CSK_RAT -
1 PsiBlast_PDB 92.8698%-206 - C- -3EAC - CSK_HUMAN -
2 PsiBlast_PDB 92.5797%-209 - C3 -1K9A - CSK_RAT -
298 HHSearch 91.4797%-200 - C- -3EAZ - CSK_HUMAN -
3 PsiBlast_PDB 91.4797%-200 - C- -3EAZ - CSK_HUMAN -
301 HHSearch 82.8857%-224 - C3 -3US4 - -
6 PsiBlast_PDB 82.6256%-224 - C3 -3US4 - -
5 PsiBlast_PDB 73.6657%-184 - C3 -1JWO - MATK_HUMAN -
299 HHSearch 62.4141%-108 - C3 -1JU5 - CRK_HUMAN -
18 PsiBlast_PDB 61.9040% -98 - C3 -3K2M - ABL1_HUMAN -
19 PsiBlast_PDB 61.5240%-112 - C3 -5DC0 - ABL1_HUMAN -
20 PsiBlast_PDB 61.1340% -99 - C3 -2ABL - ABL1_HUMAN -
311 HHSearch 60.5440%-132 - C3 -4EIH - -
17 PsiBlast_PDB 59.9540%-108 - C3 -5DC9 - -
14 PsiBlast_PDB 59.6740%-107 - C3 -3T04 - -
313 HHSearch 59.5241%-109 - C3 -2DVJ - CRK_HUMAN -
16 PsiBlast_PDB 59.0840%-105 - C3 -5DC4 - -
316 HHSearch 58.8441% -75 - C3 -2EYZ - CRK_HUMAN -
12 PsiBlast_PDB 58.4741%-184 - C3 -2RVF - ? -
30 PsiBlast_CBE 58.3640%-105 - C3 -2FO0 - ABL1_HUMAN -
283 PsiBlast_CBE 44.0133% -31 - C3 -1BHF Error
285 PsiBlast_CBE 43.0933% -22 - C3 -1LKK Error LCK_HUMAN
286 PsiBlast_CBE 43.0033% -23 - C3 -1LKL 3.4 ?