@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : C3W980_HUMAN: (2017-06-01 )
WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLC

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1CSZ)

[Raw transfer]




ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




CHAIN_B_2(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A81)
KSYK_HUMAN
[Raw transfer]

-

NH2_B_4(1CSY)

[Raw transfer]




CHAIN_H_8(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_J_10(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1CSZ)

[Raw transfer]

-

CHAIN_B_2(1CSY)

[Raw transfer]

-

CHAIN_B_2(2OQ1)
ZAP70_HUMAN
[Raw transfer]

-

CHAIN_B_2(1CSZ)

[Raw transfer]

-

CHAIN_L_12(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_F_6(1A81)
KSYK_HUMAN
[Raw transfer]

-

2 PsiBlast_PDB 99.11100% 0 - C- -4FL2 - KSYK_HUMAN -
1 PsiBlast_PDB 99.11100% 0 - C- -4FL3 - KSYK_HUMAN -
4 PsiBlast_PDB 90.92100%-160 - C2 -1CSY 4.4
25 PsiBlast_CBE 90.01100%-142 - C2 -1A81 4.6 KSYK_HUMAN
5 PsiBlast_PDB 89.25100%-166 - C2 -1CSZ 3.0
3 PsiBlast_PDB 87.67100%-160 - C2 -1A81 4.4 KSYK_HUMAN
23 PsiBlast_CBE 86.30100%-156 - C2 -1A81 5.1 KSYK_HUMAN
21 PsiBlast_CBE 84.55100%-153 - C2 -1A81 3.9 KSYK_HUMAN
22 PsiBlast_CBE 84.03100%-129 - C2 -1A81 4.8 KSYK_HUMAN
24 PsiBlast_CBE 81.35100%-161 - C2 -1A81 3.9 KSYK_HUMAN
264 Fugue 71.9795% 84 - C2 -1CSZ 2.4
8 PsiBlast_PDB 70.6551%-137 - C2 -4XZ0 Calc... ZAP70_HUMAN
11 PsiBlast_PDB 69.4951%-131 - C2 -2OQ1 6.0 ZAP70_HUMAN
10 PsiBlast_PDB 68.1451%-134 - C2 -1M61 Calc... ZAP70_HUMAN
246 HHSearch 65.0138% -79 - C2 -1OPK Calc... ABL1_MOUSE
9 PsiBlast_PDB 65.0151%-133 - C2 -4XZ1 Calc... ZAP70_HUMAN
259 HHSearch 64.1733%-114 - C2 -2YSX Calc... SHIP1_HUMAN
15 PsiBlast_PDB 63.7738% -81 - C2 -5DC4 - -
12 PsiBlast_PDB 63.2038% -80 - C2 -5DC0 - ABL1_HUMAN -
19 PsiBlast_PDB 63.0539% -79 - C2 -1OPK - ABL1_MOUSE -
260 HHSearch 46.7533% 9 - C2 -1LKK Error LCK_HUMAN