@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : E9PIJ7_HUMAN: (2017-06-02 )
WYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGLPRHFIIQAHAPSEWRLLT

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_12(3BKB)

[Raw transfer]



CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]
-
1 PsiBlast_PDB 84.8697%-112 - C3 -3BKB 1.7
4 PsiBlast_PDB 84.6097%-130 - C3 -2DCR Calc...
3 PsiBlast_PDB 81.6797%-143 - C3 -1WQU Calc...
2 PsiBlast_PDB 77.3897%-124 - C3 -4E93 Calc...
5 PsiBlast_PDB 73.9673%-116 - C3 -2KK6 - -
7 PsiBlast_PDB 60.6443% -86 - C3 -1TCE - -
62 PsiBlast_CBE 57.3639% 20 - C3 -1FYR - GRB2_HUMAN -
31 PsiBlast_CBE 57.2539% 3 - C3 -3OV1 - GRB2_HUMAN -
15 PsiBlast_PDB 56.8739% 24 - C3 -1JYR - -
65 PsiBlast_CBE 56.8039% 15 - C3 -1FYR - GRB2_HUMAN -
38 PsiBlast_CBE 56.6339% 15 - C3 -3N84 - GRB2_HUMAN -
6 PsiBlast_PDB 55.8945% -85 - C- -1MIL - -
29 PsiBlast_CBE 55.6139% 18 - C3 -3S8L - GRB2_HUMAN -
28 PsiBlast_CBE 55.5039% 15 - C3 -3S8N - GRB2_HUMAN -
69 PsiBlast_CBE 55.4139% 15 - C3 -1CJ1 - GRB2_HUMAN -
55 PsiBlast_CBE 55.2539% 16 - C3 -1ZFP - -
26 PsiBlast_CBE 55.2039% 10 - C3 -4P9V - GRB2_HUMAN -
68 PsiBlast_CBE 55.0439% 15 - C3 -1CJ1 - -
12 PsiBlast_PDB 54.9842% -29 - C- -3EAZ - CSK_HUMAN -
120 HHSearch 54.9335% -21 - C3 -2LQN Calc... CRKL_HUMAN
113 HHSearch 52.0935% 5 - C3 -3PQZ 3.1 GRB7_HUMAN