@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1853: (2018-01-21 )
MKKNFRVKREKDFKAIFKEGTSFANRKFVVYQLENQKNHFRVGLSVSKKLGNAVTRNQIKRRIRHIIQNAKGSLVEDVDFVVIARKGVETLGYAEMEKNLLHVLKLSKIYREGNGSEKETKVD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PPV_A_4(4JG4)
RNPA_BACSU
[Raw transfer]




PPV_A_4(4JG4)
RNPA_BACSU
[Raw transfer]




6 PsiBlast_PDB 82.6638%-143 - C4 -3Q1R - RNPA_THEMA -
5 PsiBlast_PDB 82.6638%-143 - C4 -3Q1Q - RNPA_THEMA -
4 PsiBlast_PDB 82.4038%-140 - C4 -1NZ0 - RNPA_THEMA -
24 HHSearch 79.1036%-111 - C4 -1NZ0 - RNPA_THEMA -
1 PsiBlast_PDB 79.0650% -9 - C4 -1A6F - RNPA_BACSU -
22 HHSearch 78.9347% 1 * C4 *4JG4 3.1 RNPA_BACSU
2 PsiBlast_PDB 78.2650% -8 - C4 -4JG4 3.1 RNPA_BACSU
21 HHSearch 74.6545% -0 - C4 -1D6T - RNPA_STAAU -
3 PsiBlast_PDB 71.9645% -5 - C4 -1D6T - RNPA_STAAU -
25 HHSearch 60.5727% -22 - C4 -2LJP - RNPA_ECOLI -
7 PsiBlast_PDB 55.3330% -6 - C4 -2LJP - RNPA_ECOLI -
10 PsiBlast_PDB 44.2327%-155 - C4 -4QSH - ? -
9 PsiBlast_PDB 43.3627%-161 - C4 -4QSK - ? -
8 PsiBlast_PDB 41.0427%-143 - C4 -4QSL - ? -
38 Fugue 40.8418%-116 - C4 -3HZQ - MSCL_STAAW -
27 HHSearch 39.6917%-124 - C4 -5F6C - RNE_ECOLI -
35 Fugue 38.8624% 61 - C4 -4CR2 - RPN1_YEAST -
20 PsiBlast_PDB 38.3922% -82 - C4 -2VKH - ? -
19 PsiBlast_PDB 37.3722% -68 - C4 -2VKD - ? -
11 PsiBlast_PDB 35.6261% -84 * C5 *3MMY - NUP98_HUMAN (first) -