@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1907: (2018-01-22 )
MTATKMNAQEIIQFIANAEKKTSVKVTFEGQLATAVPSSVVKLGNVLFGDWKDVAPLLEGLVENQDYVVEQDARNSAVPLLDKRAINARIEPGAIIRDQVEIGDNAVIMMGAVINIGAEIGAGTMIDMGAILGGRAIVGKNSHVGAGAVLAGVIEPASAEPVRVGDNVLIGANAVVIEGVQIGSGSVVAAGAIVTQDVPENVVVAGVPARIIKEIDAQTQQKTALEDALRTL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SCA_G_7(1KGT)
DAPD_UNKP
[Raw transfer]




FMT_A_13(3CJ8)
DAPH_ENTFA
[Raw transfer]




2 PsiBlast_PDB 82.1960% -82 - C2 -3CJ8 - DAPH_ENTFA -
138 HHSearch 72.8161% -41 - C2 -3CJ8 2.8 DAPH_ENTFA
1 PsiBlast_PDB 68.5562% -8 - C2 -3R8Y - DAPH_BACAN -
137 HHSearch 66.5662% -29 - C2 -3R8Y - DAPH_BACAN -
5 PsiBlast_PDB 51.6034%-141 - C2 -3GOS - DAPD_YERPE -
15 PsiBlast_PDB 50.0435%-185 - C2 -4EAB - ? -
16 PsiBlast_PDB 48.5235%-183 - C2 -4EAA - ? -
149 HHSearch 48.3437%-139 - C- -3EG4 - DAPD_BRUSU -
19 PsiBlast_PDB 47.7435%-185 - C2 -4EA9 - ? -
148 HHSearch 47.3630%-165 - C2 -4M99 - ? -
17 PsiBlast_PDB 47.0435%-188 - C2 -4EA7 - ? -
107 PsiBlast_CBE 46.8933%-105 - C2 -3FS8 - ? -
108 PsiBlast_CBE 46.8042%-202 - C2 -3EEV - ? -
18 PsiBlast_PDB 46.7335%-186 - C2 -4EA8 - ? -
10 PsiBlast_PDB 45.5633%-140 - C2 -3BXY - DAPD_ECO57 -
3 PsiBlast_PDB 45.5133%-145 - C- -3EG4 - DAPD_BRUSU -
56 PsiBlast_CBE 45.4552%-189 - C2 -3IGJ - ? -
110 PsiBlast_CBE 45.1942%-192 - C2 -3EEV - ? -
103 PsiBlast_CBE 44.9033%-106 - C2 -3FSC - ? -
58 PsiBlast_CBE 44.5352%-184 - C2 -3HJJ - ? -