@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKC7: (2017-10-26 )
MIVLGLETSCDETGLALYDSELGLRGQVLYSQIKLHAEYGGVVPELASRDHVRKLIPLMNQLLEQSGVKKQEIDAVAYTRGPGLMGALMTGALFGRTLAFSLNKPAIGVHHMEGHMLAPLLSSQPPEFPFVALLVSGGHTQLMVVHGIGQYELLGESIDDAAGEAFDKVAKMMNLPYPGGPNIAKLALSGDPLAFEFPRPMLHQGLDFSFSGLKTAVSVQLKKLNGENRDADIAASFQEAIVDTLVKKSVKALKQTGLKRLVIAGGVSANLRLREQLETSLARIKAQVYYAEPALCTDNGAMIAFAGYQRLKAGQHDGLAVTTTPRWPMTELTIPE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_6(4WQ4)
TSAD_ECOLI
[Raw transfer]




AGS_E_16(3ZEU)
TSAD_SALTY
[Raw transfer]




AGS_B_10(3ZEU)
TSAD_SALTY
[Raw transfer]




ATP_B_9(4WQ4)
TSAD_ECOLI
[Raw transfer]




ADP_A_5(4YDU)
TSAD_ECOLI
[Raw transfer]




ATP_B_14(4WQ5)
TSAD_ECOLI
[Raw transfer]




ADP_B_12(4YDU)
TSAD_ECOLI
[Raw transfer]




ATP_A_7(4WQ5)
TSAD_ECOLI
[Raw transfer]




ANP_A_3(2VWB)
KAE1B_METJA
[Raw transfer]




AGS_E_16(3ZEU)
TSAD_SALTY
[Raw transfer]




AMP_B_4(3ZET)
?
[Raw transfer]




ANP_A_3(2IVN)
KAE1_PYRAB
[Raw transfer]




AMP_B_6(3WUH)
QRI7_YEAST
[Raw transfer]




3 PsiBlast_PDB 86.8662% -60 - C2 -3ZEU 8.1 TSAD_SALTY
22 PsiBlast_CBE 86.5862% -58 - C2 -3ZEU 7.3 TSAD_SALTY
2 PsiBlast_PDB 86.1262% -61 - C2 -3ZET 6.5 ?
5 PsiBlast_PDB 85.9462% -58 - C2 -4WQ4 6.3 TSAD_ECOLI
21 PsiBlast_CBE 85.8562% -58 - C2 -4YDU 6.7 TSAD_ECOLI
4 PsiBlast_PDB 85.5062% -55 - C2 -4WQ5 7.3 TSAD_ECOLI
34 HHSearch 84.9162% -52 - C2 -3ZEU 6.5 TSAD_SALTY
23 PsiBlast_CBE 84.6862% -53 - C2 -4WQ5 7.6 TSAD_ECOLI
1 PsiBlast_PDB 84.4762% -55 - C2 -4YDU 7.1 TSAD_ECOLI
24 PsiBlast_CBE 83.7762% -59 - C2 -4WQ4 6.6 TSAD_ECOLI
53 Fugue 71.3435% -96 - C2 -2IVN - KAE1_PYRAB -
11 PsiBlast_PDB 67.2534%-108 - C2 -2VWB 6.4 KAE1B_METJA
7 PsiBlast_PDB 63.4236% -53 - C2 -2IVN 6.9 KAE1_PYRAB
8 PsiBlast_PDB 63.1536% -55 - C2 -2IVO - KAE1_PYRAB -
25 PsiBlast_CBE 62.5932% -14 - C2 -3WUH 5.4 QRI7_YEAST
9 PsiBlast_PDB 62.3036% -52 - C2 -2IVP - KAE1_PYRAB -
13 PsiBlast_PDB 61.9334% 0 - C- -3EN9 - KAE1B_METJA -
29 PsiBlast_CBE 61.1235% -33 - C2 -5JMV - KAE1B_METJA -
41 HHSearch 60.5834% -18 - C2 -2IVN - KAE1_PYRAB -
32 PsiBlast_CBE 60.5634% 0 - C- -3EN9 - KAE1B_METJA -