@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VLD9: (2017-11-02 )
MLQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLDHAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGFPIPQPVKVDQWLEGGEVLKLGEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHEQLIESIQRECFSLPDETQFISGHGPMSTIGYEKQFNPFVAGKAG

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_23(2GCU)
ETHE1_ARATH
[Raw transfer]




EDO_B_17(4EFZ)
Y2304_BURP1
[Raw transfer]




PG4_A_3(2XF4)
?
[Raw transfer]




1 PsiBlast_PDB 97.1850%-121 - C2 -2XF4 - ? -
69 HHSearch 97.0950%-121 * C2 *2XF4 3.0 ?
70 HHSearch 77.0636%-101 - C2 -2ZWR - ? -
71 HHSearch 75.8136%-105 - C2 -2ZWR - ? -
13 PsiBlast_PDB 70.6527% -60 - C2 -3TP9 - ? -
2 PsiBlast_PDB 69.5437% 2 - C2 -2ZWR - ? -
10 PsiBlast_PDB 69.2626%-102 - C2 -1XM8 - GLO2N_ARATH -
11 PsiBlast_PDB 68.7326%-103 - C2 -2Q42 - GLO2N_ARATH -
3 PsiBlast_PDB 67.8137% 0 - C2 -2ZZI - ? -
77 HHSearch 65.8327% -79 - C2 -3TP9 - ? -
72 HHSearch 65.5727% -99 - C2 -1XM8 - GLO2N_ARATH -
80 HHSearch 64.0232% -10 - C- -4YSB - ? -
78 HHSearch 63.9827% -25 - C2 -4EFZ 3.2 Y2304_BURP1
15 PsiBlast_PDB 63.1428% -30 - C2 -4EFZ - Y2304_BURP1 -
73 HHSearch 62.9633% 31 - C2 -2GCU - ETHE1_ARATH -
14 PsiBlast_PDB 61.8125% -27 - C2 -3R2U - ? -
4 PsiBlast_PDB 61.7831% 2 - C2 -4CHL - ETHE1_HUMAN -
98 Fugue 60.8227% 3 - C2 -3R2U - ? -
7 PsiBlast_PDB 60.6928% 4 - C2 -5VE4 - ? -
90 HHSearch 60.4028% -18 - C2 -5VE3 - ? -
24 PsiBlast_CBE 56.3032% 21 - C2 -2GCU 2.7 ETHE1_ARATH