@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VR89: (2017-12-01 )
MLTKTVKSFGLAMGLLACSLPLYAKNNVVVVATGGTIAGAGASSANSATYTAAKVPVDALINAVPQIQDLANVSGIQALQVASESITDKELLQIARQVNELVKKPTVNGVVITHGTDTLEETAFFLNLVVHTDKPIVLVGSMRPSTALSADGPLNLYSAVALAASDDAKNKGVMVLMNDSIFAARDVTKGINIHTNAFVSQWGALGTLVEGKPYWFRQSVKRHTNASEFNIENIKGDALPTVQIVYGSDSMLPDAYEAYAKAGAKAIIHAGTGNGSVAKYIVPTLQNLHDQNGIQIIRSSRVPQGFVLRDAEQPDSKYGWVAAHDLNPQKARLLAALALTKTNDAKEIQRMFWQY

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ASP_A_5(5K3O)
ASPG_WOLSU
[Raw transfer]




ASP_B_8(5F52)
ASPG_DICCH
[Raw transfer]




ASP_A_2(2WLT)
ASPG_HELPJ
[Raw transfer]




ASP_A_2(2WLT)
ASPG_HELPJ
[Raw transfer]




ASP_A_5(5F52)
ASPG_DICCH
[Raw transfer]




ASP_C_10(5F52)
ASPG_DICCH
[Raw transfer]




ASP_D_8(5K3O)
ASPG_WOLSU
[Raw transfer]




ASP_D_12(5F52)
ASPG_DICCH
[Raw transfer]




ASP_C_6(5I4B)
ASPG_DICCH
[Raw transfer]




ASP_C_7(5I3Z)
ASPG_DICCH
[Raw transfer]




GLU_D_8(5HW0)
ASPG_DICCH
[Raw transfer]




ASP_A_2(2WT4)
ASPG_HELPJ
[Raw transfer]




ASP_B_6(5K3O)
ASPG_WOLSU
[Raw transfer]




ASP_C_7(5K3O)
ASPG_WOLSU
[Raw transfer]




ASP_A_5(5I3Z)
ASPG_DICCH
[Raw transfer]




ASP_D_8(5I3Z)
ASPG_DICCH
[Raw transfer]




GLU_A_5(5HW0)
ASPG_DICCH
[Raw transfer]




GLU_B_6(5HW0)
ASPG_DICCH
[Raw transfer]




DAS_C_7(1HG1)
ASPG_DICCH
[Raw transfer]




GLU_C_7(5HW0)
ASPG_DICCH
[Raw transfer]




DAS_B_6(1HG1)
ASPG_DICCH
[Raw transfer]




ASP_B_6(5I3Z)
ASPG_DICCH
[Raw transfer]




SIN_B_6(1HG0)
ASPG_DICCH
[Raw transfer]




SIN_A_5(1HG0)
ASPG_DICCH
[Raw transfer]




SIN_C_7(1HG0)
ASPG_DICCH
[Raw transfer]




SIN_C_7(1HG0)
ASPG_DICCH
[Raw transfer]




SIN_D_8(1HG0)
ASPG_DICCH
[Raw transfer]




GLU_C_7(1HFW)
ASPG_DICCH
[Raw transfer]




ASP_E_5(1NNS)
ASPG2_ECOLI
[Raw transfer]




CAB_B_5(1DJO)
ASPQ_PSES7
[Raw transfer]




GLU_A_5(1HFW)
ASPG_DICCH
[Raw transfer]




GOL_A_8(5CBP)
?
[Raw transfer]




ASP_D_8(5K4G)
ASPG_WOLSU
[Raw transfer]




ASP_B_6(5K4G)
ASPG_WOLSU
[Raw transfer]




GLU_B_6(1HFW)
ASPG_DICCH
[Raw transfer]




ASP_C_7(5K4G)
ASPG_WOLSU
[Raw transfer]




ASP_B_6(5K4G)
ASPG_WOLSU
[Raw transfer]




GLU_D_8(5K45)
ASPG_WOLSU
[Raw transfer]




DAS_D_8(1HG1)
ASPG_DICCH
[Raw transfer]




GLU_C_7(5K45)
ASPG_WOLSU
[Raw transfer]




GLU_B_6(5K45)
ASPG_WOLSU
[Raw transfer]




GLU_A_5(5K45)
ASPG_WOLSU
[Raw transfer]




DDO_B_6(1JSL)
ASPG_DICCH
[Raw transfer]




DDO_A_5(1JSL)
ASPG_DICCH
[Raw transfer]




ASP_E_5(1NNS)
ASPG2_ECOLI
[Raw transfer]




ASP_G_7(1HO3)
ASPG2_ECOLI
[Raw transfer]




ASP_F_6(3ECA)
ASPG2_ECOLI
[Raw transfer]




DO2_B_7(1DJP)
ASPQ_PSES7
[Raw transfer]




DO2_B_7(1DJP)
ASPQ_PSES7
[Raw transfer]




ASP_G_7(1NNS)
ASPG2_ECOLI
[Raw transfer]




DO2_A_5(1DJP)
ASPQ_PSES7
[Raw transfer]




1 PsiBlast_PDB 94.1186%-112 - C9 -1AGX - ASPQ_ACIGL -
116 HHSearch 92.5885%-100 - C9 -1AGX - ASPQ_ACIGL -
2 PsiBlast_PDB 82.1363% -93 - C9 -4PGA - ASPQ_PSES7 -
3 PsiBlast_PDB 81.4663% -86 - C9 -1DJO - ASPQ_PSES7 -
4 PsiBlast_PDB 80.9763% -87 - C9 -1DJP 2.4 ASPQ_PSES7
120 HHSearch 80.6061% -89 - C9 -4PGA - ASPQ_PSES7 -
22 PsiBlast_CBE 80.5863% -85 - C9 -1DJP 1.3 ASPQ_PSES7
23 PsiBlast_CBE 80.2763% -83 - C9 -1DJO 2.1 ASPQ_PSES7
125 HHSearch 79.4762% -81 - C9 -1DJP 1.3 ASPQ_PSES7
71 PsiBlast_CBE 75.5942% -85 - C9 -5F52 3.3 ASPG_DICCH
74 PsiBlast_CBE 75.4742% -86 - C9 -5F52 3.2 ASPG_DICCH
84 PsiBlast_CBE 75.3641% -84 - C9 -1JSR - ASPG_DICCH -
54 PsiBlast_CBE 75.3643% -85 - C9 -2HLN - ? -
99 PsiBlast_CBE 75.3241% -91 - C9 -1HFW 3.7 ASPG_DICCH
66 PsiBlast_CBE 75.2643% -83 - C9 -2GVN - ? -
48 PsiBlast_CBE 75.1943% -85 - C9 -2JK0 - ? -
63 PsiBlast_CBE 75.1743% -82 - C9 -2GVN - ? -
62 PsiBlast_CBE 75.1543% -82 - C9 -2GVN - ? -
98 PsiBlast_CBE 75.1441% -94 - C9 -1HFW 3.7 ASPG_DICCH
75 PsiBlast_CBE 75.1141% -87 - C9 -5I3Z 2.9 ASPG_DICCH
58 PsiBlast_CBE 75.1143% -85 - C9 -2HLN - ? -
73 PsiBlast_CBE 75.0942% -87 - C9 -5F52 3.3 ASPG_DICCH
92 PsiBlast_CBE 75.0241% -85 - C9 -1HG1 4.3 ASPG_DICCH
78 PsiBlast_CBE 74.8841% -87 - C9 -5I3Z 3.1 ASPG_DICCH
67 PsiBlast_CBE 74.8742% -84 - C9 -5HW0 4.5 ASPG_DICCH
72 PsiBlast_CBE 74.7842% -86 - C9 -5F52 3.3 ASPG_DICCH
91 PsiBlast_CBE 74.6241% -87 - C9 -1HG1 4.6 ASPG_DICCH
69 PsiBlast_CBE 74.5942% -91 - C9 -5HW0 3.5 ASPG_DICCH
77 PsiBlast_CBE 74.5741% -86 - C9 -5I3Z 3.2 ASPG_DICCH
123 HHSearch 74.5042% -80 - C9 -1HG0 3.0 ASPG_DICCH
96 PsiBlast_CBE 74.4841% -83 - C9 -1HG0 3.8 ASPG_DICCH
93 PsiBlast_CBE 74.4741% -87 - C9 -1HG1 4.8 ASPG_DICCH
95 PsiBlast_CBE 74.3941% -83 - C9 -1HG0 3.0 ASPG_DICCH
97 PsiBlast_CBE 74.3841% -81 - C9 -1HG0 3.0 ASPG_DICCH
103 PsiBlast_CBE 74.2841% -84 - C9 -5I4B 3.2 ASPG_DICCH
70 PsiBlast_CBE 74.2742% -88 - C9 -5HW0 3.4 ASPG_DICCH
76 PsiBlast_CBE 74.2141% -85 - C9 -5I3Z 3.2 ASPG_DICCH
100 PsiBlast_CBE 74.1941% -90 - C9 -1HFW 3.3 ASPG_DICCH
68 PsiBlast_CBE 74.0342% -89 - C9 -5HW0 3.4 ASPG_DICCH
94 PsiBlast_CBE 74.0141% -81 - C9 -1HG0 2.8 ASPG_DICCH
118 HHSearch 72.3049% -56 - C9 -5K4G 2.8 ASPG_WOLSU
27 PsiBlast_CBE 72.1949% -44 - C9 -5K3O 4.0 ASPG_WOLSU
6 PsiBlast_PDB 71.8649% -46 - C9 -5K3O 3.0 ASPG_WOLSU
28 PsiBlast_CBE 71.6549% -46 - C9 -5K3O 2.8 ASPG_WOLSU
29 PsiBlast_CBE 71.6449% -46 - C9 -5K3O 4.0 ASPG_WOLSU
7 PsiBlast_PDB 71.4449% -48 - C9 -5K45 4.2 ASPG_WOLSU
25 PsiBlast_CBE 71.2649% -47 - C9 -5K45 3.3 ASPG_WOLSU
24 PsiBlast_CBE 71.2449% -48 - C9 -5K45 3.0 ASPG_WOLSU
10 PsiBlast_PDB 71.1542% -65 - C9 -2WLT 4.4 ASPG_HELPJ
37 PsiBlast_CBE 71.1348% -51 - C9 -5K4G 2.1 ASPG_WOLSU
36 PsiBlast_CBE 71.1048% -48 - C9 -5K4G 2.9 ASPG_WOLSU
26 PsiBlast_CBE 71.0149% -48 - C9 -5K45 3.1 ASPG_WOLSU
38 PsiBlast_CBE 70.8548% -49 - C9 -5K4G 2.8 ASPG_WOLSU
115 HHSearch 70.6146% -50 - C9 -1NNS 3.1 ASPG2_ECOLI
117 HHSearch 70.4242% -66 - C9 -2WLT 4.4 ASPG_HELPJ
11 PsiBlast_PDB 70.1942% -67 - C9 -2WT4 4.5 ASPG_HELPJ
121 HHSearch 67.7746% -48 - C9 -1HO3 2.4 ASPG2_ECOLI
13 PsiBlast_PDB 64.9246% -40 - C9 -1NNS 2.9 ASPG2_ECOLI
42 PsiBlast_CBE 64.6146% -41 - C9 -1NNS 4.4 ASPG2_ECOLI
41 PsiBlast_CBE 64.5646% -39 - C9 -3ECA 4.0 ASPG2_ECOLI