@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y2R0: (2018-02-01 )
MALAKIVYASMTGNTEEIADIVAEAFENLDIEVEINECTQVDADEFEEADICVVATYTYDDGDLPDEIVDFYEDLQELDLLGKIYGVCGSGDTFYDEFCKSVDDFDAAFAKTGASKGAENVKVDLNAEEEDIENLEAFAKELVAKI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_C_6(5LJI)
?
[Raw transfer]



FMN_A_3(5LJI)
?
[Raw transfer]
1 PsiBlast_PDB 87.8371%-125 - C1 -5LJL - ? -
41 HHSearch 87.0372%-124 - C1 -5LJL - ? -
2 PsiBlast_PDB 86.6671%-123 - C1 -5LJI 10.9 ?
21 PsiBlast_CBE 86.3771%-123 - C1 -5LJI 11.1 ?
39 HHSearch 56.0321% -72 - C1 -5B3L - Y3435_PSEAE -
48 HHSearch 55.0924% -60 - C1 -3KAQ - FLAW_DESDA -
49 HHSearch 54.4027% -43 * C1 *3F6R - FLAV_DESDE -
44 HHSearch 53.6024% -47 - C1 -4OXX - CINC_CITBR -
15 PsiBlast_PDB 53.3930% -37 - C1 -1XT6 - FLAV_DESVH -
11 PsiBlast_PDB 53.2930% -34 - C1 -1WSW - FLAV_DESVH -
22 PsiBlast_CBE 52.9632% -21 - C1 -4HEQ - FLAV_DESGI -
3 PsiBlast_PDB 52.7132% -19 - C1 -4HEQ - FLAV_DESGI -
10 PsiBlast_PDB 52.4930% -36 - C1 -1WSB - FLAV_DESVH -
43 HHSearch 52.4121% -60 - C1 -5B3K - Y3435_PSEAE -
12 PsiBlast_PDB 52.2930% -27 - C1 -1XYV - FLAV_DESVH -
28 Fugue 52.2621% 29 - C1 -1E5D - ROO_DESGI -
14 PsiBlast_PDB 52.1930% -33 - C1 -1J9E - FLAV_DESVH -
13 PsiBlast_PDB 51.7230% -36 - C1 -1XYY - FLAV_DESVH -
55 HHSearch 51.5529% -48 - C1 -4HEQ - FLAV_DESGI -
7 PsiBlast_PDB 51.4129% -26 - C1 -5V57 - ? -