@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 5HT4R_HUMAN: (2016-01-08 )
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT

Atome Classification :

(24 SA) .........10........20........30........40........50........60........70........80.-.......90........100.......110.......120.......130---.......140.......150.......160.......170.......180....--..--.--190........200........210.......220.......230------------------------------------------------------------------------------------------------------------..----------------------------.-----------------------.---------------------------.---------------------------------------------------------------------------------------.-------------------------------------------------------------------------------------------.----------------------------------------------------------------.---------------------------------------------------------------------240------------------.-.-----------.--------------.-------------.....250.--------------------------......260.......270.......280.....--..290.......--300.......310.......320.......330.......340.......350.......360.......370.......380......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELV-QDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNK---MTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVF--MV--N--KP-YAITCSVVA-FYIPFLLMVLAYYRIYVTAKEHAHQIQMLQR-------------------------------------------------------------------------------------------------------------AG----------------------------A-----------------------S---------------------------S---------------------------------------------------------------------------------------E-------------------------------------------------------------------------------------------S----------------------------------------------------------------R---------------------------------------------------------------------P--------------------Q-S-----------A--------------D-------------QHSTHRMRT--------------------------ETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDY--TVPGQVWTAFLW--LGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
85 HHSearch 95.7537%-145 - C4 -2RH1 ADRB2_HUMAN (first) A:[40-477] ------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQT-VTNYFITSLACADLVMGLAVVPFGAAHIL-MKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAI-TSPFKYQSL---LTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAI-NC----YAEETCCDF--FT--N--QA-YAIASSIVS-FYVPLVIMVFVYSRVFQEAKRQLNIFEMLRI-------------------------------------------------------------------------------------------------------------DE----------------------------G-----------------------LRLKIYKDTEGYYTIGIGHLLTKSPSLNA---------------------------------------------------------------------------------------AKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLA----------------------------------------------------------------KSRW------------------------------------------------------------------Y--------------------N-Q-----------TPNRAKRVITTFRTGT-------------WDAYKFCLK--------------------------EHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDN--LIRKEVYILLNW--IGYVNSGFNPLIYC-RSPDFRIAFQELLCL-----------------------------------------------------------
75 Fugue 95.6037%-153 - C4 -2RH1 ADRB2_HUMAN (first) A:[36-477] --------------DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTV-TNYFITSLACADLVMGLAVVPFGAAHIL-MKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAIT-SPFKYQSL---LTKNKARVIILMVWIVSGLTSFLPIQMHWYRAT-----HQEAINCYAEETCCDF--FT--N--QA-YAIASSIVS-FYVPLVIMVFVYSRVFQEAKRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM----------------------------L-----------------------Q---------------------------Q---------------------------------------------------------------------------------------K-------------------------------------------------------------------------------------------R----------------------------------------------------------------W---------------------------------------------------------------------D--------------------E-A-----------A--------------V-------------NLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDN--LIRKEVYILLNW--IGYVNSGFNPLIYCR-SPDFRIAFQELLCL-----------------------------------------------------------
90 HHSearch 92.6937%-154 - C4 -3PBL DRD3_HUMAN (first) A:[41-472] ---------------------YALSYCALILAIVFGNGLVCMAVLKERALQT-TTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAV-VMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF-GFNTTG--------------DPTVCSI--S---N--PD-FVIYSSVVS-FYLPFGVTVLVYARIYVVLKQRRRKNIFEML-------------------------------------------------------------------------------------------------------------RI----------------------------DEGLRLKIYKD-------------T---------------------------E---------------------------------------------------------------------------------------GYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVIT-------------------------------------------------------KDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNL-------------------------------------------------------------AKSRWY---------------N-Q-----------TPNR-----------AKRVITTFRTGT--WDAYGVPLR--------------------------EKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTC-HVSPELYSATTW--LGYVNSALNPVIYTTFNIEFRKAFLKILSC-----------------------------------------------------------
84 HHSearch 91.9330%-148 - C4 -3UON ACM2_HUMAN (first) A:[21-457] ----------------FEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQT-VNNYFLFSLACADLIIGVFSMNLYTLYTV-IGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCV-TKPLTYPVK---RTTKMAGMMIAAAWVLSFILWAPAIL-FWQFIVGVR---------TVEDGECYI--QFFSN--AA-VTFGTAIAA-FYLPVIIMTVLYWHISRASKSRINIFEMLRI-------------------------------------------------------------------------------------------------------------DE----------------------------GLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK---D---------------------------------------------------------------------------------------E-------------------------------------------------------------------------------------------A----------------------------------------------------------------EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNS----------------LRMLQQKRWDEAAVNLAKSRWYNQ-----------TPNRAKRVITTFRTGT-------------WDAYPPPSR--------------------------EKKVTRTILAILLAFIITWAPYNVMVLINTFCAP--CIPNTVWTIGYW--LCYINSTINPACYALCNATFKKTFKHLLM------------------------------------------------------------
88 HHSearch 90.5232%-149 - C4 -3EML ENLYS_BPT4 A:[21-471] ------------------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQN-VTNYFVVSLAAADIAVGVLAIPFAITIS---TGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAI-RIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTPML-GWNNCGQ-------SQGCGEGQVACLF--ED--VVPMNYMVYFNFFAC-VLVPLLLMLGVYLRIFLAARRQLNIFEMLRI-------------------------------------------------------------------------------------------------------------DE----------------------------G-----------------------LRLKIYKDTEGYYTIGIGHLLT------KSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQ-------------------------------------------------------------------------------------------KRWDEAAVNLAKSRWYNQ-----------------------------------------------T---------------------------------------------------------------------P--------------------N-RAKRVITTFRTGT--------------W-------------DAYRSTLQK--------------------------EVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIV--LSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ------------------------------------------------------
86 HHSearch 90.2833%-158 - C4 -3RZE ENLYS_BPT4 (first) A:[9-443] -------------------MPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT-VGNLYIVSLSVADLIVGAVVMPMNILYLL-MSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSV-QQPLRYLKY---RTKTRASATILGAWFLSFLWVI-PIL-GWNH---------------RREDKCET--DF--YDVTW-FKVMTAIIN-FYLPTLLMLWFYAKIYKAVRQHCNIFEMLRI-------------------------------------------------------------------------------------------------------------DEGLRLKIYKDTEGYYTIGIGHLLTKSPSLN-----------------------A---------------------------AKSELDKAI-------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------R----------------------------------------------------------------NTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYN---Q-T-----------P--------------NRAKRVITTFRTGTWDAYLHMNR--------------------------ERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKN--CCNEHLHMFTIW--LGYINSTLNPLIYPLCNENFKKTFKRILHI-----------------------------------------------------------
23 PsiBlast_CBE 88.2940%-154 - C4 -3ZPR ADRB1_MELGA B:[17-299] ------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTL-TNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAI-TSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDE-----DPQALKCYQDPGCCDF--VT--N--RA-YAIASSIIS-FYIPLLIMIFVALRVYREAKE---QIRKIDR-------------------------------------------------------------------------------------------------------------AS----------------------------K-----------------------R---------------------------K---------------------------------------------------------------------------------------T-------------------------------------------------------------------------------------------S----------------------------------------------------------------R---------------------------------------------------------------------V--------------------M-L-----------M--------------R-------------EH-----------------------------------KALKTLGIIMGVFTLCWLPFFLVNIVNVFNRD--LVPDWLFVAFNW--LGYANSAMNPIIYC-RSPDFRKAFKRLL-------------------------------------------------------------
4 PsiBlast_PDB 88.2140%-163 - C4 -2Y03 ADRB1_MELGA A:[17-300] ------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTL-TNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAI-TSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDE-----DPQALKCYQDPGCCDF--VT--N--RA-YAIASSIIS-FYIPLLIMIFVALRVYREAKE---QIR---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------------------------------------------R---------------------------------------------------------------------V--------------------M-L-----------M--------------R-------------EH-----------------------------------KALKTLGIIMGVFTLCWLPFFLVNIVNVFNRD--LVPDWLFVAFNW--LGYANSAMNPIIYC-RSPDFRKAFKRLLA------------------------------------------------------------
7 PsiBlast_PDB 88.2040%-159 - C4 -3ZPQ ADRB1_MELGA A:[17-300] ------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTL-TNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAI-TSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDE-----DPQALKCYQDPGCCDF--VT--N--RA-YAIASSIIS-FYIPLLIMIFVALRVYREAKE---Q-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------------------------------------------R---------------------------------------------------------------------V--------------------M-L-----------M--------------R-------------EH-----------------------------------KALKTLGIIMGVFTLCWLPFFLVNIVNVFNRD--LVPDWLFVAFNW--LGYANSAMNPIIYC-RSPDFRKAFKRLLA------------------------------------------------------------