@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0049: (2015-11-28 )
MFKSLTESLNSVFNKLKGKSIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKVIKSVSPAQMIIKVVQDNLITILGLEKSDLNLGANPPAVIMMVGLQGAGKTTTSGKLALKLKKQKKKVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDEKPTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELKTVKKIASPAEVILVADAMIGQDAVNIAKSFNETIGVTGIILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEEFDKLQKKVKKGRLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGVPDDSKVKKYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK

Atome Classification :

(47 SA) .........10........-----------20........30........40........50........60...-.....70........80........90----.-----.-..-.-----..-------..100.......110.......120...-....-130.......140.......150.......160...-.-...170.......180.......190.......200...----....------210-----.------.......220.......230.......240.-......250.......260.......270.......280.......290.......300.......310..-.....-320-...-....330.......340.......350.......360..-.-----..-----..370-----........380.......390.......400.......410.......420.......430.......440.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFKSLTESLNSVFNKLKGK-----------SIISEDDFNLAIREIRIALIEADVSLEVAKKFINDIKDKVIGEKV-IKSVSPAQMIIKVVQDNLITILGLEK-----S-----D-LN-L-----GA-------NPPAVIMMVGLQGAGKTTTSGKLALKLK-KQKK-KVMLASLDIYRPAAQKQLEVLGKQIDIQTLSTVTDE-K-PTAITKRALAAAKNDNYDVLILDTAGRLHIDDNMMNELK----TVKK------IA------S------PAEVILVADAMIGQDAVNIAKSFNETIGVTG-IILTRVDGDARGGAALSMKMVTNCPIKFIACGEKLSDLDDFYPDRIAKRILDMGDVISLVERAAEIVGQEE-FDKLQ-KKV-KKG-RLDLNDLVRMLKTLKKMDGISNIMKFIPSSFTKKLSSGV-P-----DD-----SKVK------KYIAIINSMTEKERQDPNILNGKRRLRIAKGSGTRVPDVNLLIKQYDQMSAMVNKFSKVDHSKFKESDLMDMLSRK
1 PsiBlast_PDB 90.1047% -94 - C8 -2XXA SRP54_ECOLI A:[4-423] ---NLTDRLSRTLRNISGR-----------GRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEV-NKSLTPGQEFVKIVRNELVAAMGEEN-----Q-----T-LN-L-----AA-------QPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKK-KVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQ-K-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIK----QVHA------SI------N------PVETLFVVDAMTGQDAANTAKAFNEALPLTG-VVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQ-AEKLA-SKL-KKGDGFDLNDFLEQLRQMKNMGGMASLMGK-------------------------------DDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKMKK------------------
21 PsiBlast_CBE 89.8047% -98 - C8 -2XXA SRP54_ECOLI C:[7-423] ------DRLSRTLRNISGR-----------GRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEV-NKSLTPGQEFVKIVRNELVAAMGEEN-----Q-----T-LN-L-----AA-------QPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKK-KVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQ-K-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIK----QVHA------SI------N------PVETLFVVDAMTGQDAANTAKAFNEALPLTG-VVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQ-AEKLA-SKL-KKGDGFDLNDFLEQLRQMKNMGGMASLMG--------------------------------DDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKMKK------------------
22 PsiBlast_CBE 85.8941% -93 - C8 -2FFH SRP54_THEAQ C:[1-418] MFQQLSARLQEAIGRLRGR-----------GRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQV-LESLTPAEVILATVYEALKEALGGEA-----RLPVLKD-RN-L-------------------WFLVGLQGSGKTTTAAKLALYYK-GKGR-RPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGE-S-PESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELA----RLKE------VL------G------PDEVLLVLDAMTGQEALSVARAFDEKVGVTG-LVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDVASLAEKVRAA-------------E-------LSLEDFLKQMQNLKRLGPFSEILGLLP---------GV-PQGLKVDE-----KAIK------RLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSLEK------------------
23 PsiBlast_CBE 85.6641% -93 - C8 -2FFH SRP54_THEAQ B:[1-418] MFQQLSARLQEAIGRLRGR-----------GRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQV-LESLTPAEVILATVYEALKEALGGEA-----RLPVLKD-RN-L-------------------WFLVGLQGSGKTTTAAKLALYYK-GKGR-RPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGE-S-PESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELA----RLKE------VL------G------PDEVLLVLDAMTGQEALSVARAFDEKVGVTG-LVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDVASLAEKVRAA-------------E-------LSLEDFLKQMQNLKRLGPFSEILGLLP---------GV-PQGLKVDE-----KAIK------RLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSLEK------------------
98 HHSearch 85.2634% -94 - C8 -3DM5 SRP54_PYRFU A:[2-435] VLDNLGKALANTLKKIARA-----------SSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRAL-EEKPPAGISKKEHIIKIVYEELTKFLGTEA-----K-----P-IE-I-----K--------EKPTILLMVGIQGSGKTTTVAKLARYFQ-K-RGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQ-EKD-AIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMK----QISN------VI------H------PHEVILVIDGTIGQQAYNQALAFKEATPIGS-IIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVEIKEEDI-ERF-LRG-KFTLKDMYAQLEAMRKMGP-------------------ISI-----GE-----ERLK------KFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSMNKRQLS--------------
2 PsiBlast_PDB 85.2641% -94 - C8 -2FFH SRP54_THEAQ A:[1-418] MFQQLSARLQEAIGRLRGR-----------GRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQV-LESLTPAEVILATVYEALKEALGGEA-----RLPVLKD-RN-L-------------------WFLVGLQGSGKTTTAAKLALYYK-GKGR-RPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGE-S-PESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELA----RLKE------VL------G------PDEVLLVLDAMTGQEALSVARAFDEKVGVTG-LVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDVASLAEKVRAA-------------E-------LSLEDFLKQMQNLKRLGPFSEILGLLP---------GV-PQGLKVDE-----KAIK------RLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSLEK------------------
36 PsiBlast_CBE 85.1534% -93 - C8 -3DM5 SRP54_PYRFU A:[5-435] ---NLGKALANTLKKIARA-----------SSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKP-PAGISKKEHIIKIVYEELTKFLGTEA-----K-----P-IE-I------K-------EKPTILLMVGIQGSGKTTTVAKLARYFQ-KRGY-KVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEK-D-AIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMK----QISN------VI------H------PHEVILVIDGTIGQQAYNQALAFKEATPIGS-IIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVE-IKEEDIERF-LRG-KFTLKDMYAQLEAMRKMGP-----------------------------ISIGEERLK------KFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSMNKRQLS--------------
100 HHSearch 84.2841% -90 - C8 -2FFH SRP54_THEAQ A:[1-418] MFQQLSARLQEAIGRLRGR-----------GRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEAL-GKQVLESLTPAEVILATVYEALKEALGGEA-----R--------L-P-----VL-------KDRNLWFLVGLQGSGKTTTAAKLALYYK-G-KGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMD-GES-PESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELA----RLKE------VL------G------PDEVLLVLDAMTGQEALSVARAFDEKVGVTG-LVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGDVASLAEKVRAA--------------------ELSLEDFLKQMQNLKRLGPFSEILGLLPGVPQGLK-----V-----DE-----KAIK------RLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSLEK------------------
24 PsiBlast_CBE 84.1850%-100 - C8 -4C7O SRP54_ECOLI C:[2-298] -FDNLTDRLSRTLRNISGR-----------GRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEV-NKSLTPGQEFVKIVRNELVAAMGEEN-----Q-----T-LN-L-----AA-------QPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKK-KVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQ-K-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIK----QVHA------SI------N------PVETLFVVDAMTGQDAANTAKAFNEALPLTG-VVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMG---------------------------------------------------------------------------------------------------------------------------------------------------------------------------
97 HHSearch 83.5047% -17 - C- -2XXA SRP54_ECOLI A:[4-432] ---NLTDRLSRTLRNISGR-----------GRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAV-GHEVNKSLTPGQEFVKIVRNELVAAMGEEN-----Q-----T-LN-L-----AA-------QPPAVVLMAGLQGAGKTTSVGKLGKFLR-EKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDV-GQK-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIK----QVHA------SI------N------PVETLFVVDAMTGQDAANTAKAFNEALPLTG-VVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQ-AEKLA-SKLKKGD-GFDLNDFLEQLRQMKNMGGMASLMGK--------------------DD-----KVLV------RMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKMKK------------------
35 PsiBlast_CBE 83.4834% -94 - C8 -3DM5 SRP54_PYRFU B:[5-434] ---NLGKALANTLKKIARA-----------SSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKP-PAGISKKEHIIKIVYEELTKFLGTEA-----K-----P-IE-I------K-------EKPTILLMVGIQGSGKTTTVAKLARYFQ-KRGY-KVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEK-D-AIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIE-MK----QISN------VI------H------PHEVILVIDGTIGQQAYNQALAFKEATPIGS-IIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVE-IKEEDIERF-LRG-KFTLKDMYAQLEAMRKMGP-----------------------------SIGE-ERLK------KFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSMNKRQL---------------
4 PsiBlast_PDB 83.2050%-102 - C8 -4C7O SRP54_ECOLI A:[4-296] ---NLTDRLSRTLRNISGR-----------GRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEV-NKSLTPGQEFVKIVRNELVAAMGEEN-----Q-----T-LN-L-----AA-------QPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKK-KVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQ-K-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIK----QVHA------SI------N------PVETLFVVDAMTGQDAANTAKAFNEALPLTG-VVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILG-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 82.1538% -97 - C8 -3NDB SRP54_METJA B:[4-426] ----LGENLNKALNKLKAA-----------AFVDKKLIKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKT-PKGLSKKEHIIKIVYEELVKLLGEEA-----K-----K-LE-L-----NP-------KKQNVILLVGIQGSGKTTTAAKLARYIQ-KRGL-KPALIAADTYRPAAYEQLKQLAEKIHVPIYGDETRT-KSPVDIVKEGMEKFK--KADVLIIDTAGRHKEEKGLLEEMK----QIKE------IT------N------PDEIILVIDGTIGQQAGIQAKAFKEAVGEIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLEPFDPKKFISRLLGMGDLESLLEKAEDMVDEKT-EESID--AI-MRG-KFTLNELMTQLEAIENM--------------------LT--------E-----AKIK------KYKVIISSMTKEERENPKIIKASRIRRIARGSGTTENDVREVLRYYETTKNAIDKLRKGLALALLLLLLALAL---
25 PsiBlast_CBE 81.1243%-114 - C8 -2J46 SRP54_THEAQ B:[1-297] MFQQLSARLQEAIGRLRGR-----------GRITEEDLKATLREIRRALMDA