@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : SA1730: (2016-03-28 )
MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNNQLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH

Atome Classification :

(106 SA) ---------------------------------------------------------.........10........20.-........30........40........50........60........70........80........90........100.......110---.----.-..-----.---...120.......----130---.-----.----.......140.......150.......160..-.-....170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---------------------------------------------------------MLFKEAQAFIENMYKECHYE-T-QIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAP----K----D-GP-----K---IFNNQLIRYAGYD----N-----C-----G----DPAEKEVTRLANHLGWKGKGTNFDVLPLIYQL-P-NESVKFYEYPTSLIKEVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH
109 HHSearch 98.96100%-107 - C9 -1MJT NOSO_STAAU A:[2-347] ---------------------------------------------------------HLFKEAQAFIENMYKECHYE-T-QIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAP----K----D-GP-----K---IFNNQLIRYAGYD----N-----C-----G----DPAEKEVTRLANHLGWKGKGTNFDVLPLIYQL-P-NESVKFYEYPTSLIKEVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKK------------
21 PsiBlast_CBE 98.80100%-109 - C9 -1MJT NOSO_STAAU B:[3-347] ----------------------------------------------------------LFKEAQAFIENMYKECHYE-T-QIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAP----K----D-GP-----K---IFNNQLIRYAGYD----N-----C-----G----DPAEKEVTRLANHLGWKGKGTNFDVLPLIYQL-P-NESVKFYEYPTSLIKEVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKK------------
1 PsiBlast_PDB 98.77100%-107 - C9 -1MJT NOSO_STAAU A:[3-347] ----------------------------------------------------------LFKEAQAFIENMYKECHYE-T-QIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAP----K----D-GP-----K---IFNNQLIRYAGYD----N-----C-----G----DPAEKEVTRLANHLGWKGKGTNFDVLPLIYQL-P-NESVKFYEYPTSLIKEVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKK------------
12 PsiBlast_PDB 88.4152% -96 - C9 -4UQS NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
8 PsiBlast_PDB 88.2652% -95 - C9 -4D3U NOSO_BACSU A:[9-363] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNSQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
3 PsiBlast_PDB 88.2453% -98 - C9 -1M7Z NOSO_BACSU A:[6-358] ---------------------------------------------------------ILWNEAKAFIAECYQELGKE-E-EV-KDRLDSIKSEIDRTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEDVRDALFHHIETATNNGKIRPSITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----GER---I-----G----DPASRSLTAACEQLGWRGERTDFDLLPLIFRMRG-DEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGISTNYNTDLWKDQALVELNKAVLYSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
24 PsiBlast_CBE 88.2252% -93 - C9 -4UGY NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
34 PsiBlast_CBE 88.2052% -93 - C9 -4UGM NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
50 PsiBlast_CBE 88.1052% -98 - C9 -4UG6 NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
110 HHSearch 88.0756% -98 - C9 -2FLQ ? A:[15-365] ---------------------------------------------------------QLMTKAEQFIIASYRELGKS-E-QEIKRRVNEIRWEVEQTGTYRHTYEELSYGAKMAWRHSNRCIGRLFWQSLHVIDAREAVTEEEVFSYLFHHIEVATNGGKIRPTITIFRP----N----G-EV-----R---IWNHQLIRYAGYE----TEEGI-I-----G----DSSSLTFTRACEQLGWKGEKTPFDVLPLVIQV-G-GQKPVWTPIPKELVLEVPIEHPEFPWFRDLQLKWYAVPIISDMCLEIGGIRYMAAPFNGWYMGTEIGARNFADDYRYNMLPKVASCMGLDTNSNASLWKDKALVELNIAVLYSYKKAGVSIVDHHTAARQFQLFEQQEKAAGRHVTGDWTWLIPPLSPATTHIFHRSYDNTMMLPNFFYQDR-----------
7 PsiBlast_PDB 88.0752% -95 - C9 -2FC2 NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAECYQELGKE-E-EV-KDRLDSIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEDVRDALFHHIETATNNGKIRPSITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYEAAGER-----I-----G----DPASCSLTAACEQLGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGISTNYNTDLWKDQALVELNKAVLYSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
11 PsiBlast_PDB 88.0552% -93 - C9 -4UQR NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
25 PsiBlast_CBE 88.0052% -94 - C9 -4UGX NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
4 PsiBlast_PDB 88.0053% -95 - C9 -2FC1 NOSO_BACSU A:[6-358] ---------------------------------------------------------ILWNEAKAFIAECYQELGKE-E-EV-KDRLDSIKSEIDRTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEDVRDALFHHIETATNNGKIRPSITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----GER---I-----G----DPASRSLTAACEQLGWRGERTDFDLLPLIFRMRG-DEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGISTNYNTDLWKDQALVELNKAVLYSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
15 PsiBlast_PDB 87.9552% -96 - C9 -4D3K NOSO_BACSU A:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
23 PsiBlast_CBE 87.9352% -93 - C9 -2FC2 NOSO_BACSU B:[6-360] ---------------------------------------------------------ILWNEAKAFIAECYQELGKE-E-EV-KDRLDSIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEDVRDALFHHIETATNNGKIRPSITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYEAAGER-----I-----G----DPASCSLTAACEQLGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGISTNYNTDLWKDQALVELNKAVLYSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------
53 PsiBlast_CBE 87.9252% -94 - C9 -4D3K NOSO_BACSU B:[6-360] ---------------------------------------------------------ILWNEAKAFIAACYQELGKA-A-EV-KDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPP----E----EKGE-----KQVEIWNHQLIRYAGYE----SDGER-I-----G----DPASCSLTAACEELGWRGERTDFDLLPLIFRM-KGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDK-----------