@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu07690: (2016-06-12 )
MIVTNDQELEGLKKIGRIVALAREEMKRKAEPGMSTKDLDLIGKAVLDEHGAVSAPEKEYDFPGVTCISVNDEVAHGIPSTSKILKAGDLVNIDISAEFGGFYSDTGISFVLGEGEERLHKLCQCAENAFQKGLQQAKAGKRQNQIGRAVYHEARSQGFTVIKTLTGHGIGRSLHEAPNHIMNYYDPFDNALFKNGTVIALEPFISTKAETIVEAGDGWTFKTPDKSMVAQVEHTIVITKDEPIILTKL

Atome Classification :

(52 SA) .........10........20........30--.........40.-..-.....50........60........70........80........90........100.......110....-...-120.......130.......140.......150.......160.......170.......180.......190.......200.....-..210........220.......230.......240.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MIVTNDQELEGLKKIGRIVALAREEMKRKA---EPGMSTKDLDLI-GK-AVLDEHGAVSAPEKEYDFPGVTCISVNDEVAHGIPSTSKILKAGDLVNIDISAEFGGFYSDTGISFVLGEGE-ERL-HKLCQCAENAFQKGLQQAKAGKRQNQIGRAVYHEARSQGFTVIKTLTGHGIGRSLHEAPNHIMNYYDPFDNALFKNGTVIALEPFIST-KAET-IVEAGDGWTFKTPDKSMVAQVEHTIVITKDEPIILTKL
2 PsiBlast_PDB 90.5251% -67 - C2 -1QXY MAP1_STAAM A:[1-249] MIVKTEEELQALKEIGYICAKVRNTMQAAT---KPGITTKELDNI-AK-ELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPS-KRVIREGDLVNIDVSALKNGYYADTGISFVVGESD-DPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISS-NASF-VTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
120 HHSearch 90.4852% -66 - C2 -1QXY MAP1_STAAM A:[1-248] MIVKTEEELQALKEIGYICAKVRNTMQAAT---KPGITTKELDNI-AK-ELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSK-RVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMK-QKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISS-NASF-VTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTK-
1 PsiBlast_PDB 88.7851% -69 - C2 -1QXW MAP1_STAAM A:[1-249] MIVKTEEELQALKEIGYICAKVRNTMQAAT---KPGITTKELDNI-AK-ELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPS-KRVIREGDLVNIDVSALKNGYYADTGISFVVGESD-DPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISS-NASF-VTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
3 PsiBlast_PDB 86.4551% -65 - C2 -1QXZ MAP1_STAAM A:[1-249] MIVKTEEELQALKEIGYICAKVRNTMQAAT---KPGITTKELDNI-AK-ELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPS-KRVIREGDLVNIDVSALKNGYYADTGISFVVGESD-DPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISS-NASF-VTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
49 PsiBlast_CBE 79.3035% -80 - C2 -1C23 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
52 PsiBlast_CBE 78.5032% -93 - C2 -3TB5 ? B:[8-246] ------REIEMMDESGELLADVHRHLRTFI---KPGITSWDIEVF-VR-DFIESHGGVAAQIGYEGYKYATCCSINDEICHGFPR-KKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGEST-PEI-DRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYGVVRDFVGHGIGPTIHESPM-IPHYGEAGKGLRLKEGMVITIEPMVNT-GTWR-MKMDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILT--
48 PsiBlast_CBE 78.1835% -79 - C2 -1C24 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
44 PsiBlast_CBE 78.1535% -80 - C2 -2MAT MAP1_ECOLI A:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
116 HHSearch 77.9133% -79 - C2 -3MX6 MAP1_RICPR A:[6-252] IKIHTEKDFIKMRAAGKLAAETLDFITDHV---KPNVTTNSLNDL-CH-NFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVA-IKP-KRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPS-ILNYGRNGTGLTLKEGMFFTVEPMINA-GNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL-
41 PsiBlast_CBE 77.9135% -82 - C2 -3MAT MAP1_ECOLI A:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
18 PsiBlast_PDB 77.5836% -84 - C2 -2GU7 MAP1_ECOLI A:[8-248] ------EDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
47 PsiBlast_CBE 77.4135% -81 - C2 -1C27 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
50 PsiBlast_CBE 77.3335% -79 - C2 -1C22 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
51 PsiBlast_CBE 76.5435% -78 - C2 -1C21 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
42 PsiBlast_CBE 76.5335% -77 - C2 -4PNC ? A:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
60 PsiBlast_CBE 76.4933% -85 - C2 -4FO7 ? B:[5-248] --IKTPDDIEKMRIAGRLAAEVLEMIGEHI---KPGVTTEELDRI-CHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPN-EKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTP-EWA-DRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQ-VLHYGRAGTGIELKEGMIFTIEPMINQ-GRPE-TRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILT--
46 PsiBlast_CBE 76.3835% -71 - C2 -4MAT MAP1_ECOLI A:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
115 HHSearch 76.0732% -89 - C2 -3TB5 ? A:[2-247] ITLKSPREIEMMDESGELLADVHRHLRTFI---KPGITSWDIEVF-VR-DFIESHGGVAAQIGYEGYKYATCCSINDEICHGFPRK-KVLKDGDLIKVDMCVDLKGAISDSCWSYVVGEST-PEI-DRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYGVVRDFVGHGIGPTIHESPM-IPHYGEAGKGLRLKEGMVITIEPMVNT-GTWR-MKMDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILTS-
13 PsiBlast_PDB 75.7535% -77 - C2 -2Q92 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
6 PsiBlast_PDB 75.6535% -82 - C2 -2BB7 MAP1_ECOLI A:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
27 PsiBlast_CBE 75.6435% -79 - C2 -4A6V ? B:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
43 PsiBlast_CBE 75.5335% -77 - C2 -4A6W ? A:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
71 PsiBlast_CBE 75.4433% -75 - C2 -3MX6 MAP1_RICPR A:[8-245] --IHTEKDFIKMRAAGKLAAETLDFITDHV---KPNVTTNSLNDL-CH-NFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPN-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVA-IKP-KRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPS-ILNYGRNGTGLTLKEGMFFTVEPMINAGNYDT-ILSKLDGWTVTTRDKSLSAQFEHTIGVTKD--------
30 PsiBlast_CBE 74.8235% -80 - C2 -2Q95 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
8 PsiBlast_PDB 74.5135% -75 - C2 -2EVM MAP1_ECOLI A:[5-249] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
32 PsiBlast_CBE 74.2935% -81 - C2 -2GGC MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--
70 PsiBlast_CBE 74.2733% -73 - C2 -3MX6 MAP1_RICPR B:[8-245] --IHTEKDFIKMRAAGKLAAETLDFITDHV---KPNVTTNSLNDL-CH-NFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPN-DKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVA-IKP-KRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPS-ILNYGRNGTGLTLKEGMFFTVEPMINAGNYDT-ILSKLDGWTVTTRDKSLSAQFEHTIGVTKD--------
84 PsiBlast_CBE 74.1032% -79 - C2 -3IU7 MAP12_MYCTU A:[44-288] --VQTPEVIEKMRVAGRIAAGALAEAGKAV---APGVTTDELDRI-AH-EYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPD-STVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVA-DEH-RLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFTGHGIGTTFHNG-LVVLHYDQPAVETIMQPGMTFTIEPMINL-GALD-YEIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL
11 PsiBlast_PDB 74.0235% -79 - C2 -2P98 MAP1_ECOLI A:[4-248] --IKTPEDIEKMRVAGRLAAEVLEMIEPYV---KPGVSTGELDRICND-YIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPT-IMG-ERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRETNVVLKPGMTFTIEPMVNA-GKKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILT--