@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu11330: (2016-06-17 )
MKAGILGVGRYIPEKVLTNHDLEKMVETSDEWIRTRTGIEERRIAADDVFSSHMAVAAAKNALEQAEVAAEDLDMILVATVTPDQSFPTVSCMIQEQLGAKKACAMDISAACAGFMYGVVTGKQFIESGTYKHVLVVGVEKLSSITDWEDRNTAVLFGDGAGAAVVGPVSDDRGILSFELGADGTGGQHLYLNEKRHTIMNGREVFKFAVRQMGESCVNVIEKAGLSKEDVDFLIPHQANIRIMEAARERLELPVEKMSKTVHKYGNTSAASIPISLVEELEAGKIKDGDVVVMVGFGGGLTWGAIAIRWGR

Atome Classification :

(37 SA) .........10........20....-....30........40.....-...50----........60........70........80........90........100.......110.......120.......130.......140......-.150.......160.......170.......180..------...-----.----.190----------.-------.------------.------------.--------.-------..-----------.200-------------........210.......220.....-..230.......240.......250.-...-..--.260........270.......280-........290-........300.......310-
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKAGILGVGRYIPEKVLTNHDLEKM-VETSDEWIRTRTGIEERRIAA-DDVFS----SHMAVAAAKNALEQAEVAAEDLDMILVATVTPDQSFPTVSCMIQEQLGAKKACAMDISAACAGFMYGVVTGKQFIESGTYKHVLVVGVEKLSSITDW-EDRNTAVLFGDGAGAAVVGPVSDDRGILSFELGADG------TGG-----Q----HLY-----------L-------N------------E------------K--------R-------HT-----------IMN--------------GREVFKFAVRQMGESCVNVIEKAGLS-KEDVDFLIPHQANIRIMEAARERLEL-PVE-KM--SK-TVHKYGNTSAASIPISLVEEL--EAGKIKDGDV--VVMVGFGGGLTWGAIAIRWGR-
77 HHSearch 87.6753%-118 - C2 -2EBD - FABH_AQUAE A:[1-309] MGTKIIGTGVYLPKNVLTNFDLEKI-VDTSDEWITTRTGIKERRIAK--EETI----TYMATQAAKEALREANLSPEELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAEKLSEAVDW-EDRSTCVLFGDGAGAVVVTRSEDKSDILATRMYAEG------SLE-----E----LLH-----------A-------D------------N------------C--------G-------YI-----------RMK--------------GRELFKVAVRSMEEVCREVLEKAGVK-PEEVSLVIPHQANVRIINALAEKLNI-PKE-KV--FV-NIQKYGNTSAASIPIALHEAI--KEGKVKRGDL--ILMTAMGGGLTWGAVLLRY---
3 PsiBlast_PDB 87.3852%-117 - C2 -2EBD - FABH_AQUAE A:[1-309] MGTKIIGTGVYLPKNVLTNFDLEKI-VDTSDEWITTRTGIKERRIAK-EETIT-----YMATQAAKEALREANLSPEELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAEKLSEAVDW-EDRSTCVLFGDGAGAVVVTRSEDKSDILATRMYAEG------SLE-----E----LLH-----------A-------D------------N------------C--------G-------YI-----------RMK--------------GRELFKVAVRSMEEVCREVLEKAGVK-PEEVSLVIPHQANVRIINALAEKLNI-PKE-KV--FV-NIQKYGNTSAASIPIALHEAI--KEGKVKRGDL--ILMTAMGGGLTWGAVLLRY---
21 PsiBlast_CBE 87.3650%-116 - C2 -1UB7 ? D:[2-320] --SGILALGAYVPERVMTNADFEAY-LDTSDEWIVTRTGIKERRVAA-EDEYT----SDLAFKAVEDLLRRHPGALEGVDAVIVATNTPDALFPDTAALVQARFGLK-AFAYDLLAGCPGWIYALAQAHALVEAGLAQKVLAVGAEALSKIIDW-NDRATAVLFGDGGGAAVVGKVREGYGFRSFVLGADG------TGA-----K----ELYHACVAPRLPDGT-------S------------M------------K--------N-------RL-----------YMN--------------GREVFKFAVRVMNTATLEAIEKAGLT-PEDIRLFVPHQANLRIIDAARERLGL-PWE-RV--AV-NVDRYGNTSTASIPLALKEAV--DAGRIREGDH--VLLVSFGAGLTWAAAVLTWG--
20 PsiBlast_PDB 85.3342%-122 - C2 -1EBL FABH_ECOLI A:[5-317] ----IIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNND-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
88 Fugue 85.3153%-114 * C2 *1UB7 ? A:[2-322] --SGILALGAYVPERVMTNADFEAYL-DTSDEWIVTRTGIKERRVAAE-----DEYTSDLAFKAVEDLLRRHPGALEGVDAVIVATNTPDALFPDTAALVQARFGLK-AFAYDLLAGCPGWIYALAQAHALVEAGLAQKVLAVGAEALSKIIDWN-DRATAVLFGDGGGAAVVGKVREGYGFRSFVLGADG------TGA-----K----ELY-----------H-------A------------C------------V--------A-------PRLPDGTSMKNRLYMN--------------GREVFKFAVRVMNTATLEAIEKAGL-TPEDIRLFVPHQANLRIIDAARERLGL-PWE-R-VA-V-NVDRYGNTSTASIPLALKEAVDA--GRIREGDH--VLLVSFGAGLTWAAAVLTWGGA
22 PsiBlast_CBE 85.3050%-112 - C2 -1UB7 ? C:[2-320] --SGILALGAYVPERVMTNADFEAY-LDTSDEWIVTRTGIKERRVAA-EDEYT----SDLAFKAVEDLLRRHPGALEGVDAVIVATNTPDALFPDTAALVQARFGLK-AFAYDLLAGCPGWIYALAQAHALVEAGLAQKVLAVGAEALSKIIDW-NDRATAVLFGDGGGAAVVGKVREGYGFRSFVLGADG------TGA-----K----ELYHACVAPRLPDGT-------S------------M------------K--------N-------RL-----------YMN--------------GREVFKFAVRVMNTATLEAIEKAGLT-PEDIRLFVPHQANLRIIDAARERLGL-PWE-RV--AV-NVDRYGNTSTASIPLALKEAV--DAGRIREGDH--VLLVSFGAGLTWAAAVLTWG--
12 PsiBlast_PDB 84.8444%-121 - C2 -2EFT FABH_ECOLI A:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
9 PsiBlast_PDB 84.5644%-122 - C2 -1HND FABH_ECOLI A:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
33 PsiBlast_CBE 84.5144%-120 - C2 -1HN9 FABH_ECOLI B:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
8 PsiBlast_PDB 84.5044%-120 - C2 -1HN9 FABH_ECOLI A:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
13 PsiBlast_PDB 84.3344%-119 - C2 -2GYO FABH_ECOLI A:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
23 PsiBlast_CBE 84.2650%-111 - C2 -1UB7 ? B:[2-320] --SGILALGAYVPERVMTNADFEAY-LDTSDEWIVTRTGIKERRVAA-EDEYT----SDLAFKAVEDLLRRHPGALEGVDAVIVATNTPDALFPDTAALVQARFGLK-AFAYDLLAGCPGWIYALAQAHALVEAGLAQKVLAVGAEALSKIIDW-NDRATAVLFGDGGGAAVVGKVREGYGFRSFVLGADG------TGA-----K----ELYHACVAPRLPDGT-------S------------M------------K--------N-------RL-----------YMN--------------GREVFKFAVRVMNTATLEAIEKAGLT-PEDIRLFVPHQANLRIIDAARERLGL-PWE-RV--AV-NVDRYGNTSTASIPLALKEAV--DAGRIREGDH--VLLVSFGAGLTWAAAVLTWG--
31 PsiBlast_CBE 84.1944%-120 - C2 -2GYO FABH_ECOLI B:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
4 PsiBlast_PDB 83.4050%-111 - C2 -1UB7 ? A:[2-320] --SGILALGAYVPERVMTNADFEAY-LDTSDEWIVTRTGIKERRVAA-EDEYT----SDLAFKAVEDLLRRHPGALEGVDAVIVATNTPDALFPDTAALVQARFGLK-AFAYDLLAGCPGWIYALAQAHALVEAGLAQKVLAVGAEALSKIIDW-NDRATAVLFGDGGGAAVVGKVREGYGFRSFVLGADG------TGA-----K----ELYHACVAPRLPDGT-------S------------M------------K--------N-------RL-----------YMN--------------GREVFKFAVRVMNTATLEAIEKAGLT-PEDIRLFVPHQANLRIIDAARERLGL-PWE-RV--AV-NVDRYGNTSTASIPLALKEAV--DAGRIREGDH--VLLVSFGAGLTWAAAVLTWG--
32 PsiBlast_CBE 83.1944%-121 - C2 -2EFT FABH_ECOLI B:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
10 PsiBlast_PDB 83.0844%-120 - C2 -1HNJ FABH_ECOLI A:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
61 HHSearch 82.1344%-118 - C2 -1HNJ FABH_ECOLI A:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLAASEE-PGIISTHLHADG------SYG-----E----LLT-----------L-------P------------N------------ADRVNPENSI-------HL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
62 HHSearch 81.2051%-109 - C2 -1UB7 ? A:[2-321] --SGILALGAYVPERVMTNADFEAY-LDTSDEWIVTRTGIKERRVAA-EDEYT----SDLAFKAVEDLLRRHPGALEGVDAVIVATNTPDALFPDTAALVQARFGL-KAFAYDLLAGCPGWIYALAQAHALVEAGLAQKVLAVGAEALSKIIDW-NDRATAVLFGDGGGAAVVGKVREGYGFRSFVLGADG------TGA-----KELYHACVAPR--------L-------P------------D------------GTSMK----N-------RL-----------YMN--------------GREVFKFAVRVMNTATLEAIEKAGLT-PEDIRLFVPHQANLRIIDAARERLGL-PWE-RV--AV-NVDRYGNTSTASIPLALKEAV--DAGRIREGDH--VLLVSFGAGLTWAAAVLTWGG-
16 PsiBlast_PDB 80.9043%-115 - C2 -3IL9 - FABH_ECOLI A:[1-317] MYTKIIGTGSYLPEQVRTNADLEKM-VDTSDEWIVTRTGIRERHIAA-PNETV----STMGFEAATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAA-AGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDP-TDRGTIIIFGDGAGAAVLA-ASEEPGIISTHLHADG------SYG-----E----LLT-----------LP------N------------A------------D--------RVNPENSIHL-----------TMA--------------GNEVFKVAVTELAHIVDETLAANNLD-RSQLDWLVPHQANLRIISATAKKLGM-SMD-NV--VV-TLDRHGNTSAASVPCALDEAV--RDGRIKPGQL--VLLEAFGGGFTWGSALVRF---
5 PsiBlast_PDB 80.6143%-122 - C2 -4WZU FABH2_VIBCH A:[6-325] --AEITGWGKCLPPATLSNHDLSTF-LDTSDEWIQSRTGIEQRRIS---HVNT----SDLATVAAQHAIACAGVSVEEIDLIIVATCSPDSLIPNIASRVQQNLGIPSAAAFDLNAACTGFLYGLETATRLMQASHYRHALVIGAERLSFYLDW-TKRDTAVLFGDGAGAVVLSKTEQKVGLQDAQIGCDA------QGR-----D----ILA-----------V--------------------P------------K--------F-------GT-----------AMDRFDADNGYWAFDFVGKEIFKRAVRGMGAAAQQVLARSGLS-TEEIDVVIPHQANIRIIQTLCDLAGI-AQD-KA--FV-NIHRYGNTSAATVPIALCEAL--EQGKIKPHDD--LLVAAFGAGLTWGAGHIRWG--
43 PsiBlast_CBE 79.2637%-115 - C2 -2QO1 FABH_MYCTU A:[14-331] ---GLLSVGAYRPERVVTNDEICQH-IDSSDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
44 PsiBlast_CBE 78.8337%-116 - C2 -2QNZ FABH_MYCTU B:[14-331] ---GLLSVGAYRPERVVTNDEIC------SDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
49 PsiBlast_CBE 78.7437%-116 - C2 -1HZP FABH_MYCTU A:[14-331] ---GLLSVGAYRPERVVTNDEICQH-IDSSDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
47 PsiBlast_CBE 78.6137%-115 - C2 -2QNX FABH_MYCTU A:[14-331] ---GLLSVGAYRPERVVTNDEICQH-IDSSDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
48 PsiBlast_CBE 78.1037%-114 - C2 -1HZP FABH_MYCTU B:[14-331] ---GLLSVGAYRPERVVTNDEICQH-IDSSDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
41 PsiBlast_CBE 77.6437%-115 - C2 -2QX1 FABH_MYCTU A:[14-331] ---GLLSVGAYRPERVVTNDEICQH-IDSSDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
46 PsiBlast_CBE 76.1537%-111 - C2 -2QNX FABH_MYCTU B:[14-331] ---GLLSVGAYRPERVVTNDEIC---IDSSDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
42 PsiBlast_CBE 75.4937%-112 - C2 -2QO1 FABH_MYCTU B:[14-331] ---GLLSVGAYRPERVVTNDEICQH-IDSSDEWIYTRTGIKTRRFAA-DDESA----ASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDM-YDRGNCFIFADGAAAVVVGE-TPFQGIGPTVAGSDG------EQA-----D----AIR-----------Q-------DIDWITFAQNPSGP------------R--------P-------FV-----------RLE--------------GPAVFRWAAFKMGDVGRRAMDAAGVR-PDQIDVFVPHQANSRINELLVKNLQLRPDA-VV--AN-DIEHTGNTSAASIPLAMAELL--TTGAAKPGDL--ALLIGYGAGLSYAAQVVR----
34 PsiBlast_CBE 75.4842%-116 - C2 -3IL5 FABH_ENTFA D:[25-339] --ARISCTSRYVPENCVTNHQLSEM-MDTSDEWIHSRTGISERRIVT-QEN-T----SDLCHQVAKQLLEKSGKQASEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYALSMAEKLVLSGRYQTGLVIGGETFSKMLDW-TDRSTAVLFGDGA-AGVLIEAAETPHFLNEKLQADGQRWAALTSGYTINES----PFY-----------Q-------G------------H------------K--------Q-------ASKTL--------QME--------------GRSIFDFAIKDVSQNILSLV-----T-DETVDYLLLHQANVRIIDKIARKTKI-SRE-KF--LT-NMDKYGNTSAASIPILLDEAV--ENGTLILGSQQRVVLTGFGGGLTWGSLLL-----
39 PsiBlast_CBE 75.0538%-114 - C2 -1MZJ FABH_STRLI A:[14-329] ----VLGVGSYRPRREVSNKEVCTW-IDSTEEWIETRTGIRSRRIAE-PDETI----QVMGVAASRRALEHAGVDPAEIDLVVVSTMTNFVHTPPLSVAIAHELGADNAGGFDLSAACAGFCHALSIAADAVESGGSRHVLVVATERMTDVIDL-ADRSLSFLFGDGAGAAVVGP-SDVPGIGPVVRGIDG------TGL-----G----SLH-----------M-------S------------SSWDQYVEDPSVGR--------P-------AL-----------VMD--------------GKRVFRWAVADVVPAAREALEVAGLT-VGDLVAFVPHQANLRIIDVLVDRLGV-PEHVVV--SR-DAEDTGNTSSASVALALDRLV--RSGAVPGGGP--ALMIGFGAGLSYAGQAL-----
38 PsiBlast_CBE 75.0538%-116 - C2 -1MZJ FABH_STRLI B:[14-329] ----VLGVGSYRPRREVSNKEVCTW-IDSTEEWIETRTGIRSRRIAE-PDETI----QVMGVAASRRALEHAGVDPAEIDLVVVSTMTNFVHTPPLSVAIAHELGADNAGGFDLSAACAGFCHALSIAADAVESGGSRHVLVVATERMTDVIDL-ADRSLSFLFGDGAGAAVVGP-SDVPGIGPVVRGIDG------TGL-----G----SLH-----------M-------S------------SSWDQYVEDPSVGR--------P-------AL-----------VMD--------------GKRVFRWAVADVVPAAREALEVAGLT-VGDLVAFVPHQANLRIIDVLVDRLGV-PEHVVV--SR-DAEDTGNTSSASVALALDRLV--RSGAVPGGGP--ALMIGFGAGLSYAGQAL-----