@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu13180: (2016-06-20 )
MTTIKTSNLGFPRIGLNREWKKALEAYWKGSTDKDTFLKQIDELFLSAVKTQIDQQIDVVPVSDFTQYDHVLDTAVSFNWIPKRFRHLTDATDTYFAIARGIKDAVSSEMTKWFNTNYHYIVPEYDESIEFRLTRNKQLEDYRRIKQEYGVETKPVIVGPYTFVTLAKGYEPSEAKAIQKRLVPLYVQLLKELEEEGVKWVQIDEPALVTASSEDVRGAKELFESITSELSSLNVLLQTYFDSVDAYEELISYPVQGIGLDFVHDKGRNLEQLKTHGFPTDKVLAAGVIDGRNIWKADLEERLDAVLDILSIAKVDELWIQPSSSLLHVPVAKHPDEHLEKDLLNGLSYAKEKLAELTALKEGLVSGKAAISEEIQQAKADIQALKQFATGANSEQKKELEQLTDKDFKRPIPFEERLALQNESLGLPLLPTTTIGSFPQSAEVRSARQKWRKAEWSDEQYQNFINAETKRWIDIQEELELDVLVHGEFERTDMVEYFGEKLAGFAFTKYAWVQSYGSRCVRPPVIYGDVEFIEPMTVKDTVYAQSLTSKHVKGMLTGPVTILNWSFPRNDISRKEIAFQIGLALRKEVKALEDAGIQIIQVDEPALREGLPLKTRDWDEYLTWAAEAFRLTTSSVKNETQIHTHMCYSNFEDIVDTINDLDADVITIEHSRSHGGFLDYLKNHPYLKGLGLGVYDIHSPRVPSTEEMYNIIVDALAVCPTDRFWVNPDCGLKTRQQEETVAALKNMVEAAKQARAQQTQLV

Atome Classification :

(23 SA) .........10..-......20........30........40........50.-.......60........70.....-...80....-....90-.-......-..100.----------......-110........120.......130...---.---...140.......150.......160......----.-----170--.-----.---......--180.......190.......200.......-210...-....-220........230..-......240....-....250.-.-.-....-.260.......270...--..--..280.......290.......300.......310.......320.......330.......340.....-..350.......360.......--370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490..-.....500.......510.......520.......530...-....540....-...-550.-..-....560.......570.......580.......590.......600.......610.-..-.-...620.......630.......640...-....650.......-660.......670...-....680-.-.-.-....690.......700.......710..-.....720.......730.......740....-...750.......760
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTTIKTSNLGFPR-IGLNREWKKALEAYWKGSTDKDTFLKQIDELFLSAVKTQ-IDQQIDVVPVSDFTQYDHVLDTAV-SFNWIPKRF-RHLTD--A-TDTYFA-IARGIK----------DAVSSE-M-TKWFNTNYHYIVPEYDESIEFRLTR---N---KQLEDYRRIKQEYGVETKPVIVGPYTFVTLAK----G-----YE---P-----S---EAKAIQ--KRLVPLYVQLLKELEEEGVKWVQIDEPALV-TASSED-VRGA-K-ELFESITSEL-SSL-NVLLQTYF-DSVD-AYEELI-S-Y-P-VQGI-GLDFVHDKGRNLEQLKT--HG--FPTDKVLAAGVIDGRNIWKADLEERLDAVLDILSIAKVDELWIQPSSSLLHVPVAKHPDEHLEKDLLNGL-SYAKEKLAELTALKEGLVSGKA--AISEEIQQAKADIQALKQFATGANSEQKKELEQLTDKDFKRPIPFEERLALQNESLGLPLLPTTTIGSFPQSAEVRSARQKWRKAEWSDEQYQNFINAETKRWIDIQEELELDVLVHGEFERTDM-VEYFGEKLAGFAFTKYAWVQSYGSRCVRPPVIYGDVEFIEP-MTVKDTVYAQS-LTS-KHVK-GM-LTGPVTILNWSFPRNDISRKEIAFQIGLALRKEVKALEDAGIQIIQVDEPALREGLPL-KT-R-DWDEYLTWAAEAFRLTTSSVKNETQIHTH-MCYSNFEDIVDTIN-DLDADVITIEHSRSHG-GFLDYLK-N-H-P-YLKGLGLGVYDIHSPRVPSTEEMYNIIVD-ALAVCPTDRFWVNPDCGLKTRQQEETVAALKN-MVEAAKQARAQQTQLV
3 PsiBlast_PDB 84.2750% -70 - C4 -3T0C METE_STRMU A:[34-774] -SMTKVSSLGYPR-LGENREWKKLIEAYWAGKVSKNDLFAGAKELRLDFLKKQ-LNAGLDLIPVGDFSLYDHILDLSV-QFNIIPKRF-AKEPI--D-IDLYFA-IARGN-----------ENVASS-M-KKWFNTNYHYIVPEWSKQ-RPKLNN---N---RLLDLYLEAREVVGDKAKPVITGPITYVALST----G-----VE-------------DFTAAV--KSLLPLYKQVFTELVKAGASYIQVDEPIFV-TDEGKDYLQAA-K-AVYAYFAKEV-PDA-KFIFQTYF-EGLI-DSQVLS-Q-L-P-VDAF-GLDFVYGLEENLEAIKT--GA--FKGKEIFA-GVIDGRNIWSSDFV-KTSALLETIE-EQSAALTIQPSCSLLHVPVTTKNETDLDPVLRNGL-AFADEKLTEVKRLAEHL-DGRE--DPAYDLHIAHFD-------ALQAADFRNVKLEDLSRVATKRPSDFAKRRDIQQEKLHLPLLPTTTIGSFPQS--IRRTR-AW--GDISDAEYKQFIQAEIERWIRIQEDLDLDVLVHGEFERVDM-VEFFGQKLAGFTTTKFGWVQSYGSRAVKPPIIYGDVQHLEP-ITVEETVYAQS-LTD-RPVK-GM-LTGPITITNWSFERTDIPRDQLFNQIGLAIKDEIKLLENAGIAIIQVDEAALREGLPL-RK-S-KQKAYLDDAVHAFHIATSSVKDETQIHTH-MCYSKFDEIIDAIR-ALDADVISIETSRSHG-DIIESFE-T-A-V-YPLGIGLGVYDIHSPRVPTKEEVVANIER-PLRQLSPTQFWVNPDCGLKTRQEPETIAALK--LVAATKEVR-------
2 PsiBlast_PDB 83.8350% -72 - C4 -3L7R METE_STRMU A:[35-774] --MTKVSSLGYPR-LGENREWKKLIEAYWAGKVSKNDLFAGAKELRLDFLKKQ-LNAGLDLIPVGDFSLYDHILDLSV-QFNIIPKRF-AKEPI--D-IDLYFA-IARGNK----------ENVASS-M-KKWFNTNYHYIVPEWSKQ-RPKLNN---N---RLLDLYLEAREVVGDKAKPVITGPITYVALST----G-----VE-------------DFTAAV--KSLLPLYKQVFTELVKAGASYIQVDEPIFV-TDEGKDYLQAA-K-AVYAYFAKEV-PDA-KFIFQTYF-EGLI-DSQVLS-Q-L-P-VDAF-GLDFVYGLEENLEAIKT--GA--FKGKEIFA-GVIDGRNIWSSDFV-KTSALLETIE-EQSAALTIQPSCSLLHVPVTTKNETDLDPVLRNGL-AFADEKLTEVKRLAEHL-DGRE--DPAYDLHIAHFD-------ALQAADFRNVKLEDLSRVATKRPSDFAKRRDIQQEKLHLPLLPTTTIGSFPQS--IRRTR-AW--GDISDAEYKQFIQAEIERWIRIQEDLDLDVLVHGEFERVDM-VEFFGQKLAGFTTTKFGWVQSYGSRAVKPPIIYGDVQHLEP-ITVEETVYAQS-LTD-RPVK-GM-LTGPITITNWSFERTDIPRDQLFNQIGLAIKDEIKLLENAGIAIIQVDEAALREGLPL-RK-S-KQKAYLDDAVHAFHIATSSVKDETQIHTH-MCYSKFDEIIDAIR-ALDADVISIETSRSHG-DIIESFE-T-A-V-YPLGIGLGVYDIHS--VPTKEEVVANIER-PLRQLSPTQFWVNPDCGLKTRQEPETIAALKV-LVAATKEVR-------
30 HHSearch 83.3744% -68 - C4 -4L6H METE_CANAL A:[23-789] --MVQSSVLGFPR-IGGQRELKKITEAYWSGKATVEELLAKGKELREHNWKLQ-QKAGVDIIPSNDFSYYDQVLDLSL-LFNAIPERY-TKFDLA-P-IDVLFA-MGRGLQAAATQAAV--DVTALE-M-VKWFDSNYHYVRPTFSHSTEFKLNTAAGI---KPVDEFNEAK-ALGVQTRPVILGPVSYLYLGK----A-----DKDSLD-----L---EPISLL--PKILPVYKELLQKLKEAGAEQVQIDEPVLV-LDLPEAVQSKF-K-EAYDALVGA--DVP-ELILTTYF-GDVR-PNLKAI-ENL-P-VAGF-HFDFVRVP-EQLDEVAS---I--LKDGQTLSAGVVDGRNIWKTDFAKASAVVQKAIEKVGKDKVVVATSSSLLHTPVDLESETKLDAVIKDWF-SFATQKLDEVVVIAKNVSGEDV----SKQLEANAASIKARSESSITNDPKVQERLTTINEALATRKAAFPERLTEQKAKYNLPLFPTTTIGSFPQTKDIRINRNKFAKGQITAEEYEAFINKEIETVVRFQEEIGLDVLVHGEPERNDM-VQYFGEQLNGFAFTTNGWVQSYGSRYVRPPIIVGDVSRPKA-MTVKESVYAQS-ITS-KPMK-GM-LTGPVTILRWSFPRDDVSGKIQALQLGLALRDEVNDLEGAGITVIQVDEPAIREGLPL-RA-GKERSDYLNWAAQSFRVATSGVENSTQIHSH-FC---LDP--NHIK-ALDADVVSIEFSK-DDPNYIQEFS-E-----YPNHIGLGLFDIHSPRIPSKQEFVSRIEE-ILKVYPASKFWVNPDCGLKTRGWPEVKESLTN-MVEAAKEFRAKY----
17 PsiBlast_PDB 83.0843% -68 - C4 -3PPH - METE_CANAL A:[1-766] --MVQSSVLGFPR-IGGQRELKKITEAYWSGKATVEELLAKGKELREHNWKLQ-QKAGVDIIPSNDFSYYDQVLDLSL-LFNAIPERY-TKFDL--APIDVLFA-MGRGLQTTATTTQAAVDVTALE-M-VKWFDSNYHYVRPTFSHSTEFKLNT---AAGIKPVDEFNEAKA-LGVQTRPVILGPVSYLYLGK----A-----DK---D-----SLDLEPISLL--PKILPVYKELLQKLKEAGAEQVQIDEPVLV-LDLPEA-VQSKFK-EAYDALVGA--DVP-ELILTTYF-GDVR-PNLKAIEN-L-P-VAGF-HFDFV----RVPEQLDE--VASILKDGQTLSAGVVDGRNIWKTDFAKASAVVQKAIEKVGKDKVVVATSSSLLHTPVDLESETKLDAVIKDWF-SFATQKLDEVVVIAKN-VSGED---VSKQLEANAASIKARSESSITNDPKVQERLTTINEALATRKAAFPERLTEQKAKYNLPLFPTTTIGSFPQTKDIRINRNKFAKGQITAEEYEAFINKEIETVVRFQEEIGLDVLVHGEPERNDM-VQYFGEQLNGFAFTTNGWVQSYGSRYVRPPIIVGDVSRPKA-MTVKESVYAQS-ITS-KPMK-GM-LTGPVTILRWSFPRDDVSGKIQALQLGLALRDEVNDLEGAGITVIQVDEPAIREGLPL-RAGK-ERSDYLNWAAQSFRVATSGVENSTQIHSH-FCY--LDP--NHIK-ALDADVVSIEFSKKDDPNYIQEFS-E-Y-P---NHIGLGLF--------SKQEFVSRIEE-ILKVYPASKFWVNPDCGLKTRGWPEVKESLTN-MVEAAKEFRAK-----
14 PsiBlast_PDB 83.0843% -67 - C4 -4L6H METE_CANAL A:[23-788] --MVQSSVLGFPR-IGGQRELKKITEAYWSGKATVEELLAKGKELREHNWKLQ-QKAGVDIIPSNDFSYYDQVLDLSL-LFNAIPERY-TKFDL--APIDVLFA-MGRGLQAAATQAAV--DVTALE-M-VKWFDSNYHYVRPTFSHSTEFKLNT---AAGIKPVDEFNEAKA-LGVQTRPVILGPVSYLYLGK----A-----DK---D-----SLDLEPISLL--PKILPVYKELLQKLKEAGAEQVQIDEPVLV-LDLPEA-VQSKFK-EAYDALVGA--DVP-ELILTTYF-GDVR-PNLKAIEN-L-P-VAGF-HFDFV----RVPEQLDE--VASILKDGQTLSAGVVDGRNIWKTDFAKASAVVQKAIEKVGKDKVVVATSSSLLHTPVDLESETKLDAVIKDWF-SFATQKLDEVVVIAKN-VSGED---VSKQLEANAASIKARSESSITNDPKVQERLTTINEALATRKAAFPERLTEQKAKYNLPLFPTTTIGSFPQTKDIRINRNKFAKGQITAEEYEAFINKEIETVVRFQEEIGLDVLVHGEPERNDM-VQYFGEQLNGFAFTTNGWVQSYGSRYVRPPIIVGDVSRPKA-MTVKESVYAQS-ITS-KPMK-GM-LTGPVTILRWSFPRDDVSGKIQALQLGLALRDEVNDLEGAGITVIQVDEPAIREGLPL-RAGK-ERSDYLNWAAQSFRVATSGVENSTQIHSH-FC---LDP--NHIK-ALDADVVSIEFSK-DDPNYIQEFS-E-Y-P---NHIGLGLFDIHSPRIPSKQEFVSRIEE-ILKVYPASKFWVNPDCGLKTRGWPEVKESLTN-MVEAAKEFRAK-----
13 PsiBlast_PDB 82.8643% -69 - C4 -4L65 METE_CANAL A:[23-788] --MVQSSVLGFPR-IGGQRELKKITEAYWSGKATVEELLAKGKELREHNWKLQ-QKAGVDIIPSNDFSYYDQVLDLSL-LFNAIPERY-TKFDL--APIDVLFA-MGRGLQ-----------VTALE-M-VKWFDSNYHYVRPTFSHSTEFKLNT---AAGIKPVDEFNEAKA-LGVQTRPVILGPVSYLYLGK----A-----DK---D-----SLDLEPISLL--PKILPVYKELLQKLKEAGAEQVQIDEPVLV-LDLPEA-VQSKFK-EAYDALVGA--DVP-ELILTTYF-GDVR-PNLKAIEN-L-P-VAGF-HFDFV----RVPEQLDE--VASILKDGQTLSAGVVDGRNIWKTDFAKASAVVQKAIEKVGKDKVVVATSSSLLHTPVDLESETKLDAVIKDWF-SFATQKLDEVVVIAKN-VSGED---VSKQLEANAASIKARSESSITNDPKVQERLTTINEALATRKAAFPERLTEQKAKYNLPLFPTTTIGSFPQTKDIRINRNKFAKGQITAEEYEAFINKEIETVVRFQEEIGLDVLVHGEPERNDM-VQYFGEQLNGFAFTTNGWVQSYGSRYVRPPIIVGDVSRPKA-MTVKESVYAQS-ITS-KPMK-GM-LTGPVTILRWSFPRDDVSGKIQALQLGLALRDEVNDLEGAGITVIQVDEPAIREGLPL-RAGK-ERSDYLNWAAQSFRVATSGVENSTQIHSH-FCYSDLDP--NHIK-ALDADVVSIEFS-----NYIQEFS-E-Y-P---NHIGLGLFDIHSPRIPSKQEFVSRIEE-ILK-YPASKFWVNPDCGLKTRGWPEVKESLTN-MVEAAKEFRAK-----
7 PsiBlast_PDB 82.6945% -87 - C4 -3BQ6 METE_THEMA A:[34-762] ----KAYAFGFPK-IGEKREFKKALEDFWKGKITEEQFEEEMNKLRMYMVEN--YRKNVDVIPSNELSYYDFVLDTAV-MVGAVPERF-GEYR---G-LSTYFD-MARGGK-------------ALE-M-TKFFNTNYHYLVPEI-ETEEFYLLE---N---KPLEDYLFFKSK-GIETAPWVIGPFTFLYLSK----RNGEWIRR---P-----N---QMEKLL--ESLVSVYKEVFEKLVENGCKEILVNEPAFV-C----D-LEKA-HWDLILNVYREL-SEF-PLTVFTYY-DSVS-DYEACV-S-L-P-VKRL-HFDFVSNE-ENLKNLEK--HG--FPEDKKLVAGVINGRQPWKVDLRKVASLVEKLGASA------ISNSCPLFHLPVTLELENNLPGGLKEKL-AFAKEKLEELKMLKD-FLEGKTFDLP----------LQAVER------------VRNLPEDSFRREKEYTERDRIQRERLNLPLFPTTTIGSFPQTPEVRKMRSKYRK----KEEYEAFIKEQIKKAIELQEEIGLDVLVHGEFERTDM-VEFFAEKLNGIATTQNGWVLSYGSRCYRPPIIYGTVTRPEP-MTLKEITYAQS-LTE-KPVK-GM-LTGPVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEPAFREKAPI-KK-S-KWPEYFEWAINAFNLAANA-RPETQIHAH-MCYSDFNEIIEYIH-QLEFDVISIEASRSKG-EIISAFE-N-F-KGWIKQIGVGVWDIHSPAVPSINEMREIVER-VLRVLPKELIWINPDCGLKTRNWDEVIPSLRN-MVALAKEMRE------
8 PsiBlast_PDB 82.6643% -72 - C4 -4ZTX ? A:[2-762] ---VQSSVLGFPR-MGVLRDLKKANEAYWADKISQEALLAEGKRLRLAHWKIQ-KDAGVDIIPSNDFAHYDHVLDHIQ-LFNAVPERYTSQKLS--P-LDEYFA-MGRGHQKGGV------DVPALE-M-VKWFDSNYHYVKPTLQDNQTFSLAK---DP--KPVREFLEAK-EAGFQTRPVLVGPVSFLALGK----A-----DR---G-----S---SVDPITLLDKLVPVYVELLKQLKAAGAESVQIDEPVLV-FDLRPE-VKAAFK-PAYEAIAAAG-DAVPKVVVATYFGDIVH-NFDVLP-A-F-SGAAGL-HVDLV----RNPEQLEPVLKQ--LGPNQILSAGVVDGRNIWKNDFAKSLEILQTAVKALGSERVIVATSSSLIHTPHTLASEKKLPSDVYEWF-SFAVEKVKEVATLAKA-VTEPE--AVKAELEANAAAIKARTDSKRTNDPAVKERQAQVTPEQHNRKAPFNTRYAEQKKHLSLPLFPTTTIGSFPQTSEIRVQRNKFTKGEISAEEYERFIEKEIELAVKIQDELDLDVYVHGEPERNDM-VQYFGERLNGYVFTTHAWVQSYGSRCVRPPIIVGDISRPAP-MTVKESKYAAS-ISK-KPMK-GM-LTGPVTCLRWSFPRVDVHQSVQCQQLALALRDEVVDLEKNGIYVIQVDEPALREGLPLRKG-Q-EREAYLKWAVDSFKLATAGVENSTQIHSH-FCYSEFQDFFHAIA-ALDADVLSIENSKSDA-KLLKVFI-D-E-E-YPRHIGPGVYDIHSPRVPTLEEFKQRIEE-MLAYLKPEQLWINPDCGLKTRKWDEVKGALSH-MVEAAKYFR-------
23 PsiBlast_CBE 82.4645% -88 - C4 -3BQ5 METE_THEMA B:[34-762] ----KAYAFGFPK-IGEKREFKKALEDFWKGKITEEQFEEEMNKLRMYMVEN--YRKNVDVIPSNELSYYDFVLDTAV-MVGAVPERF-GEYR---G-LSTYFD-MARGGK-------------ALE-M-TKFFNTNYHYLVPEI-ETEEFYLLE---N---KPLEDYLFFKSK-GIETAPWVIGPFTFLYLSK----RNGEWIRR---P-----N---QMEKLL--ESLVSVYKEVFEKLVENGCKEILVNEPAFV-C----D-LEKA-HWDLILNVYREL-SEF-PLTVFTYY-DSVS-DYEACV-S-L-P-VKRL-HFDFVSNE-ENLKNLEK--HG--FPEDKKLVAGVINGRQPWKVDLRKVASLVEKLGASA------ISNSCPLFHLPVTLELENNLPGGLKEKL-AFAKEKLEELKMLKD-FLEGKTFDLPN------AVDLQAVER------------VRNLPEDSFRREKEYTERDRIQRERLNLPLFPTTTIGSFPQTPEVRKMRSKYRK--ISKEEYEAFIKEQIKKAIELQEEIGLDVLVHGEFERTDM-VEFFAEKLNGIATTQNGWVLSYGSRCYRPPIIYGTVTRPEP-MTLKEITYAQS-LTE-KPVK-GM-LTGPVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEPAFREKAPI-KK-S-KWPEYFEWAINAFNLAANA-RPETQIHAH-MCYSDFNEIIEYIH-QLEFDVISIEASRSKG-EIISAFE-N-F-KGWIKQIGVGVWDIHSPAVPSINEMREIVER-VLRVLPKELIWINPDCGLKTRNWDEVIPSLRN-MVALAKEMRE------
28 HHSearch 82.1852% -78 - C4 -2NQ5 - METE_STRMU A:[1-742] --LTKVSSLGYPR-LGENREWKKLIEAYWAGKVSKNDLFAGAKELRLDFLKKQ-LNAGLDLIPVGDFSLYDHILDLSV-QFNIIPKRF-AKEPI--D-IDLYFA-IARGNK----------ENVASS-M-KKWFNTNYHYIVPEWSK-QRPKLNN---N---RLLDLYLEAREVVGDKAKPVITGPITYVALST----G-----VE-------------DFTAAV--KSLLPLYKQVFTELVKAGASYIQVDEPIFV-TDEGKDYLQAA-K-AVYAYFAKEV-PDA-KFIFQTYF-EGLI-D-SQVL-SQL-P-VDAF-GLDFVYGLEENLEAIKT---G--AFKGKEIFAGVIDGRNIWSSDFVKTSALLETIEEQ--SAALTIQPSCSLLHVPVTTKNETDLDPVLRNGL-AFADEKLTEVKRLAEHLDGRED-----PAYDLHIAHFDALQAADF-RNV----KLEDLSRVATKRPSDFAKRRDIQQEKLHLPLLPTTTIGSFPQ-----------------DAEYKQFIQAEIERWIRIQEDLDLDVLVHGEFERVDM-VEFFGQKLAGFTTTKFGWVQSYGSRAVKPPIIYGDVQHLEP-ITVEETVYAQS-LTD-RPVK-GM-LTGPITITNWSFERTDIPRDQLFNQIGLAIKDEIKLLENAGIAIIQVDEAALREGLPL-RK-S-KQKAYLDDAVHAFHIATSSVKDETQIHTH-MCYSKFDEIIDAIR-ALDADVISI------------------------LGIGLGVYDIHSPRVPTKEEVVANIER-PLRQLSPTQFWVNPDCGLKTRQEPETIAALKV-LVAATKEVRQK-----
22 PsiBlast_CBE 82.1145% -86 - C4 -3BQ6 METE_THEMA B:[34-763] ----KAYAFGFPK-IGEKREFKKALEDFWKGKITEEQFEEEMNKLRMYMVEN--YRKNVDVIPSNELSYYDFVLDTAV-MVGAVPERF-GEYR---G-LSTYFD-MARGGK-------------ALE-M-TKFFNTNYHYLVPEI-ETEEFYLLE---N---KPLEDYLFFKSK-GIETAPWVIGPFTFLYLSK----RNGEWIRR---P-----N---QMEKLL--ESLVSVYKEVFEKLVENGCKEILVNEPAFV-C----D-LEKA-HWDLILNVYREL-SEF-PLTVFTYY-DSVS-DYEACV-S-L-P-VKRL-HFDFVSNE-ENLKNLEK--HG--FPEDKKLVAGVINGRQPWKVDLRKVASLVEKLGASA------ISNSCPLFHLPVTLELENNLPGGLKEKL-AFAKEKLEELKMLKD-FLEGKT-------------DLQAVER------------VRNLPEDSFRREKEYTERDRIQRERLNLPLFPTTTIGSFPQTPEVRKMRSKYRKGEISKEEYEAFIKEQIKKAIELQEEIGLDVLVHGEFERTDM-VEFFAEKLNGIATTQNGWVLSYGSRCYRPPIIYGTVTRPEP-MTLKEITYAQS-LTE-KPVK-GM-LTGPVTIMSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEPAFREKAPI-KK-S-KWPEYFEWAINAFNLAANA-RPETQIHAH-MCYSDFNEIIEYIH-QLEFDVISIEASRSKG-EIISAFE-N-F-KGWIKQIGVGVWDIHSPAVPSINEMREIVER-VLRVLPKELIWINPDCGLKTRNWDEVIPSLRN-MVALAKEMREK-----
9 PsiBlast_PDB 81.9143% -71 - C4 -4ZTY ? A:[2-762] ---VQSSVLGFPR-MGVLRDLKKANEAYWADKISQEALLAEGKRLRLAHWKIQ-KDAGVDIIPSNDFAHYDHVLDHIQ-LFNAVPERYTSQKLS--P-LDEYFA-MGRGHQKGGV------DVPALE-M-VKWFDSNYHYVKPTLQDNQTFSLAK---DP--KPVREFLEAK-EAGFQTRPVLVGPVSFLALGK----A-----DR---G-----S---SVDPITLLDKLVPVYVELLKQLKAAGAESVQIDEPVLV-FDLRPE-VKAAFK-PAYEAIAAAG-DAVPKVVVATYFGDIVH-NFDVLP-A-F-SGAAGL-HVDLV----RNPEQLEPVLKQ--LGPNQILSAGVVDGRNIWKNDFAKSLEILQTAVKALGSERVIVATSSSLIHTPHTLASEKKLPSDVYEWF-SFAVEKVKEVATLAKA-VTEPE--AVKAELEANAAAIKARTDSKRTNDPAVKERQAQVTPEQHNRKAPFNTRYAEQKKHLSLPLFPTTTIGSFPQTSEIRVQRNKFTKGEISAEEYERFIEKEIELAVKIQDELDLDVYVHGEPERNDM-VQYFGERLNGYVFTTHAWVQSYGSRCVRPPIIVGDISRPAP-MTVKESKYAAS-ISK-KPMK-GM-LTGPVTCLRWSFPRVDVHQSVQCQQLALALRDEVVDLEKNGIYVIQVDEPALREGLPLRKG-Q-EREAYLKWAVDSFKLATAGVENSTQIHSH-FCYSEFQDFFHAIA-ALDADVLSIENSKSDA-KLLKVFI-D-E-E-YPRHIGPGVYDIHSPRVPTLEEFKQRIEE-MLAYLKPEQLWINPDCGLKTRKWDEVKGALSH-MVEAAKYFR-------