@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu16130: (2016-06-25 )
MFKLDLQPTEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELGVAYSDPLADGPVIQRASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLQENHIDGLLVPDLPLEESNSLQEECKSHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRNEFNSSVYPFIRTVKNLSTVPVAVGFGISNREQVIKMNEISDGVVVGSALVRKIEELKDRLISAETRNQALQEFEDYAMAFSGLYSLK

Atome Classification :

(67 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150-.-...-....160.......170.......180........190.......200.......210.-..-..-.-.-220.......230.......240.......250.......260.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MFKLDLQPTEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELGVAYSDPLADGPVIQRASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLQENHIDGLLVPDLPLEESNSLQEECKSHEVTYISLVAP-T-S-ESR-LKTIIEQAEGFVYCVSSLGVTGVRNE-FNSSVYPFIRTVKNLSTVPVAVGFGISNREQV-IK-MN-E-I-SDGVVVGSALVRKIEELKDRLISAETRNQALQEFEDYAMAFSGLYSLK
2 PsiBlast_PDB 84.6639%-151 - C1 -1RD5 TRPA_MAIZE A:[20-254] ------------FIPYITAGDPDLATTAEALRLLDGCGADVIELGVPCSDPYIDGPIIQASVARALASGTTMDAVLEMLREVTPE-LSCPVVLLSYYKPIMFRS----LAKMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTP-AIP-EDR-MKEITKASEGFVYLVSVNGVTGPRAN-VNPRVESLIQEVKKVTNKPVAVGFGISKPEHV-KQ-IA-Q-WGADGVIIGSAMVRQLGE-------AASPKQGLRRLEEYA----------
104 HHSearch 83.9440%-146 - C1 -1RD5 TRPA_MAIZE A:[15-261] -------KGKTAFIPYITAGDPDLATTAEALRLLDGCGADVIELGVPCSDPYIDGPIIQASVARALASGTTMDAVLEMLREVTP-ELSCPVVLLSYYKPIMF----RSLAKMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTP-A-IPEDR-MKEITKASEGFVYLVSVNGVTGPR-ANVNPRVESLIQEVKKVTNKPVAVGFGISKPEHV-KQ-IAQW-G-ADGVIIGSAMVRQLGEAASP-------KQGLRRLEEYARGMKNAL---
16 PsiBlast_PDB 83.8433%-206 - C- -3THA - TRPA_CAMJE A:[14-229] -------------VAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKTKK---ALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSV-T-TPKER-VKKLVKHAKGFIYLLASIGITGTKSV-EEAILQDKVKEIRSFTNLPIFVGFGIQNNQDV-KR-MR-K-V-ADGVIVGTSIVK------------------------------------
5 PsiBlast_PDB 83.7239%-135 - C1 -1TJR TRPA_MAIZE A:[19-253] ------------FIPYITAGDPDLATTAEALRLLDGCGADVIELGVPCSDPYIDGPIIQASVARALASGTTMDAVLEMLREVTPE-LSCPVVLLSYYKPIMSRS----LAEMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTP-AIP-EDR-MKEITKASEGFVYLVSVNGVTGPRAN-VNPRVESLIQEVKKVTNKPVAVGFGISKPEHV-KQ-IA-Q-WGADGVIIGSAMVRQLGE-------AASPKQGLRRLEEYA----------
88 Fugue 83.2737%-156 - C1 -1GEQ - TRPA_PYRFU A:[1-248] MFK------DGSLIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLY-------E-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VS-LL-KEG-ANGVVVGSALVKIIGEK---------GREATEFLKKKVEELLGI----
97 HHSearch 82.8543%-170 * C1 *1UJP TRPA_THET2 A:[13-251] -------EGRAALIPYLTAGFPSREGFLQAVEEVL-PYADLLEIGLPYSD----GPVIQRASELALRKGMSVQGALELVREVRA-LTEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAP-T-STDAR-IATVVRHATGFVYAVSV-------------EVKDLVRRIKARTALPVAVGFGVSGKATA-AQ-A--A-V-ADGVVVGSALVRALEEG-------------------------------
100 HHSearch 82.6832%-194 - C- -3THA - TRPA_CAMJE A:[3-235] --DFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKT---KKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSV-T-TPKER-VKKLVKHAKGFIYLLASIGITGTK-SVEEAILQDKVKEIRSFTNLPIFVGFGIQNNQDV-KR-MR-K-V-ADGVIVGTSIVKCFKQGN------------------------------
14 PsiBlast_PDB 82.2539%-152 - C1 -2E09 - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKAFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
103 HHSearch 81.9937%-150 - C1 -1GEQ - TRPA_PYRFU A:[3-246] --------KDGSLIPYLTAGDPDKQSTLNFLLALDE-YAGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRR-HSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAP-N-TPDER-LKVIDDMTTGFVYLVSLY-------E-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VS-LLKE-G-ANGVVVGSALVKIIGEKGRE---------ATEFLKKKVEELL------
10 PsiBlast_PDB 81.6639%-159 - C1 -5E0K - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLY------EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
15 PsiBlast_PDB 81.6039%-160 - C1 -2DZT - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVAGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
4 PsiBlast_PDB 81.1439%-154 - C1 -2DZS - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAAAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
11 PsiBlast_PDB 80.6939%-156 - C1 -2DZP - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPNKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
8 PsiBlast_PDB 80.5039%-158 - C1 -1GEQ - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLY-------E-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
7 PsiBlast_PDB 80.4839%-153 - C1 -2DZW - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
12 PsiBlast_PDB 80.3839%-156 - C1 -2DZV - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-AER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
13 PsiBlast_PDB 79.8239%-155 - C1 -2DZU - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVNGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
6 PsiBlast_PDB 79.4939%-156 - C1 -2DZX - TRPA_PYRFU A:[7-229] ------------LIPYLTAGDPDKQSTLNFLLALDEY-AGAIELGIPFSDPIADGKTIQESHYRALKNGFKLREAFWIVKEFRRHS-STPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVFHAKEFTEIARAAGIKTVFLAAPNT-P-DER-LKVIDDMTTGFVYLVSLYGT----EE-IPKTAYDLLRRAKRICRNKVAVGFGVSKREHV-VSLLK-E-G-ANGVVVGSALVKIIGE--------------------------------
1 PsiBlast_PDB 78.7940%-163 - C1 -1WXJ TRPA_THET2 A:[18-257] ------------LIPYLTAGFPSREGFLQAVEEVLPY-ADLLEIGLPYS-----GPVIQRASELALRKGMSVQGALELVREVRAL-TEKPLFLMTYLNPVLAWGPERFFGLFKQAGATGVILPDLPPDEDPGLVRLAQEIGLETVFLLAP-T-STDAR-IATVVRHATGFVYAVS--------------EVKDLVRRIKARTALPVAVGFGVSGK-AT-AA-QA-A-V-ADGVVVGSALVRALEEGRSLAPLLQEIRQGLQRLE-------------
21 PsiBlast_CBE 78.6739%-151 - C1 -1RD5 TRPA_MAIZE B:[20-254] ------------FIPYITAGDPDLATTAEALRLLDGCGADVIELGVPCSDP--DGPIIQASVARALASGTTMDAVLEMLREVTPE-LSCPVVLLSYYKPIMFRS----LAKMKEAGVHGLIVPDLPYVAAHSLWSEAKNNNLELVLLTTP-AIP-EDR-MKEITKASEGFVYLVSV------------PRVESLIQEVKKVTNKPVAVGFGISKPEHV-KQ-IA-Q-WGADGVIIGSAMVRQLGE-------AASPKQGLRRLEEYA----------
62 PsiBlast_CBE 74.2935%-140 - C1 -1WBJ TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
61 PsiBlast_CBE 74.2935%-140 - C1 -2CLK TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
63 PsiBlast_CBE 74.2735%-139 - C1 -1QOP TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
31 PsiBlast_CBE 72.8935%-138 - C1 -4HN4 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
55 PsiBlast_CBE 72.5735%-138 - C1 -1C8V TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
49 PsiBlast_CBE 72.5735%-150 - C1 -1K7E TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG--------PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
40 PsiBlast_CBE 72.3435%-143 - C1 -2CLI TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG-----------HLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
44 PsiBlast_CBE 72.3235%-141 - C1 -1TJP TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
27 PsiBlast_CBE 72.0235%-133 - C1 -4KKX TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
60 PsiBlast_CBE 71.9835%-138 - C1 -3CEP TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
53 PsiBlast_CBE 71.9735%-138 - C1 -1CW2 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
54 PsiBlast_CBE 71.9535%-139 - C1 -1C9D TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
56 PsiBlast_CBE 71.8935%-137 - C1 -1C29 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
58 PsiBlast_CBE 71.7835%-139 - C1 -1A50 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN-------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
30 PsiBlast_CBE 71.7335%-136 - C1 -4HPJ TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
72 PsiBlast_CBE 71.7235%-149 - C1 -1KFB TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSR--------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
50 PsiBlast_CBE 71.7235%-136 - C1 -1K3U TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
45 PsiBlast_CBE 71.6435%-153 - C1 -1QOQ TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
57 PsiBlast_CBE 71.6035%-139 - C1 -1A5S TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN---------LIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
47 PsiBlast_CBE 71.5235%-157 - C1 -1K8Y TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS--------------PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
25 PsiBlast_CBE 71.4935%-136 - C1 -4XUG TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
46 PsiBlast_CBE 71.3935%-152 - C1 -1K8Z TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS------------ALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
29 PsiBlast_CBE 71.3335%-136 - C1 -4HPX TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
23 PsiBlast_CBE 71.3335%-142 - C1 -4ZQC ? A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
51 PsiBlast_CBE 71.3135%-139 - C1 -1FUY TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
32 PsiBlast_CBE 71.2735%-137 - C1 -2TSY TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAEN-------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
28 PsiBlast_CBE 71.2735%-136 - C1 -4HT3 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
36 PsiBlast_CBE 71.2035%-136 - C1 -2J9X TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G---LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
35 PsiBlast_CBE 71.1235%-154 - C1 -2RH9 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
75 PsiBlast_CBE 70.9435%-151 - C1 -1KFC TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
48 PsiBlast_CBE 70.7635%-157 - C1 -1K7F TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS---------------LHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
42 PsiBlast_CBE 70.7135%-148 - C1 -2CLF TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
26 PsiBlast_CBE 70.5735%-152 - C1 -4WX2 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
59 PsiBlast_CBE 70.5235%-141 - C1 -3PR2 TRPA_SALTY A:[15-242] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-GALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
73 PsiBlast_CBE 70.3235%-148 - C1 -1BEU TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTY----------------LPLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
34 PsiBlast_CBE 70.2335%-151 - C1 -2RHG TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS------------------LIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
43 PsiBlast_CBE 70.2135%-151 - C1 -2CLE TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
38 PsiBlast_CBE 70.1435%-150 - C1 -2CLM TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLS----------------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
41 PsiBlast_CBE 70.0535%-146 - C1 -2CLH TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTG----------HHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
52 PsiBlast_CBE 70.0235%-138 - C1 -1CX9 TRPA_SALTY A:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPP-N-A-DDDLLRQVASYGRGYTYLLSRSGVTGAENR-G--PLHHLIEKLKEYHAAPALQGFGISSPEQVSAA-VR-A-G-AAGAISGSAIVKIIEK--------------------------------
76 PsiBlast_CBE 69.5535%-156 - C1 -1WQ5 TRPA_ECOLI B:[16-243] ---------EGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPL-----IQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPP-N-A-DDDLLRQIASYGRGYTYLLSRAGVT--ENR-AALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAA-ID-A-G-AAGAISGSAIVKIIEQ--------------------------------