@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA1686: (2016-01-31 )
MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG

Atome Classification :

(42 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180-..---.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQ---AN---LDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG
1 PsiBlast_PDB 96.4037%-108 - C6 -3OGD 3MG2_ECOLI A:[11-280] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQCVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
46 PsiBlast_CBE 96.1437%-107 - C6 -1MPG 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
4 PsiBlast_PDB 95.5037%-106 - C6 -1MPG 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
29 PsiBlast_CBE 95.2537%-111 - C6 -3CWT 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
34 PsiBlast_CBE 95.2337%-108 - C6 -3CWA 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
25 PsiBlast_CBE 95.0137%-106 - C6 -3CWU 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
43 PsiBlast_CBE 94.9337%-107 - C6 -3CVS 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
8 PsiBlast_PDB 94.9337%-109 - C6 -3CVT 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
5 PsiBlast_PDB 94.9337%-108 - C6 -1DIZ 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
33 PsiBlast_CBE 94.8337%-108 - C6 -3CWA 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
93 HHSearch 94.7337%-109 - C6 -1MPG 3MG2_ECOLI A:[1-277] --------MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNG------ALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDD---FPEYICFPTPQRLAAADPQA---LKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPG----MTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
3 PsiBlast_PDB 94.6937%-110 - C6 -3OH9 3MG2_ECOLI A:[11-280] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDC-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
45 PsiBlast_CBE 94.6837%-107 - C6 -1PVS 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
23 PsiBlast_CBE 94.6637%-108 - C6 -3D4V 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
14 PsiBlast_PDB 94.4337%-106 - C6 -3D4V 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
42 PsiBlast_CBE 94.1837%-106 - C6 -3CVS 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
2 PsiBlast_PDB 94.1537%-105 - C6 -3OH6 3MG2_ECOLI A:[11-280] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDC-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
22 PsiBlast_CBE 94.1337%-109 - C6 -3D4V 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
27 PsiBlast_CBE 94.0337%-109 - C6 -3CWT 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
26 PsiBlast_CBE 94.0337%-110 - C6 -3CWU 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
28 PsiBlast_CBE 93.9237%-105 - C6 -3CWT 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
38 PsiBlast_CBE 93.8537%-109 - C6 -3CW7 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
6 PsiBlast_PDB 93.8137%-110 - C6 -1PVS 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
30 PsiBlast_CBE 93.7937%-107 - C6 -3CWS 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
7 PsiBlast_PDB 93.7837%-108 - C6 -3CVS 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
31 PsiBlast_CBE 93.7737%-108 - C6 -3CWS 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
32 PsiBlast_CBE 93.7637%-110 - C6 -3CWS 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
47 PsiBlast_CBE 93.7537%-109 - C6 -1DIZ 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
10 PsiBlast_PDB 93.7337%-106 - C6 -3CWA 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
12 PsiBlast_PDB 93.7037%-109 - C6 -3CWT 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
37 PsiBlast_CBE 93.6837%-110 - C6 -3CW7 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
36 PsiBlast_CBE 93.6837%-108 - C6 -3CW7 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
21 PsiBlast_CBE 93.6137%-107 - C6 -3D4V 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
13 PsiBlast_PDB 93.6037%-105 - C6 -3CWU 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
39 PsiBlast_CBE 93.5137%-108 - C6 -3CVT 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
35 PsiBlast_CBE 93.3337%-107 - C6 -3CWA 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
40 PsiBlast_CBE 93.1437%-105 - C6 -3CVT 3MG2_ECOLI C:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
41 PsiBlast_CBE 93.0737%-109 - C6 -3CVT 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
9 PsiBlast_PDB 93.0337%-110 - C6 -3CW7 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
24 PsiBlast_CBE 92.9537%-107 - C6 -3CWU 3MG2_ECOLI D:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
44 PsiBlast_CBE 92.6737%-111 - C6 -3CVS 3MG2_ECOLI B:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPE---YICFPTPQRLAA---ADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDY-LIKQRF---PGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQP
11 PsiBlast_PDB 92.5037%-107 - C6 -3CWS 3MG2_ECOLI A:[4-273] -----------LNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIV------NGALGRLGAARPGLRLPGCVDAFEQGVRAILG