@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK5_HUMAN: (2015-10-05 )
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Atome Classification :

(98 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




1QK_A_3(4KD1)
CDK2_HUMAN
[Raw transfer]




CK7_C_8(2WEV)
CDK2_HUMAN
[Raw transfer]




EZV_A_2(3EZV)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




EZR_A_2(3EZR)
CDK2_HUMAN
[Raw transfer]




RRC_A_5(1UNL)
CDK5_HUMAN
[Raw transfer]




PDY_A_3(3WBL)
CDK2_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




MTZ_A_7(2UUE)
CDK2_HUMAN
[Raw transfer]




3O0_B_5(3O0G)
CDK5_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




MTZ_C_8(2UUE)
CDK2_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




ALH_A_5(1UNG)
CDK5_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




PVB_B_4(1V0P)
CDC2H_PLAFK
[Raw transfer]




X1N_C_7(2X1N)
CDK2_HUMAN
[Raw transfer]




GOL_A_4(3N9X)
?
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




PVB_A_3(1V0P)
CDC2H_PLAFK
[Raw transfer]




1N3_A_2(3ULI)
CDK2_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




1YG_A_2(4LYN)
CDK2_HUMAN
[Raw transfer]




C96_A_2(2UZN)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




INR_B_4(1V0O)
CDC2H_PLAFK
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




740_A_2(2R64)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




56H_A_2(5D1J)
?
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




Z3R_B_10(4AU8)
CDK5_HUMAN
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




INR_A_3(1V0O)
CDC2H_PLAFK
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




3I6_A_2(4BGH)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




C62_A_2(2UZO)
CDK2_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




ADP_A_5(4NST)
CDK12_HUMAN
[Raw transfer]




DRK_A_3(3EB0)
?
[Raw transfer]




107_E_5(1FVV)
CDK2_HUMAN
[Raw transfer]




D6I_A_3(4BZD)
CDK2_HUMAN
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




DTQ_B_2(1DI8)
CDK2_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(3N9X)
?
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




LQ5_A_2(5A14)
?
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




PVB_A_2(1CKP)
CDK2_HUMAN
[Raw transfer]




106_A_2(1FVT)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1FIN)
CDK2_HUMAN
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




ESJ_A_2(4D1X)
CDK2_HUMAN
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(1CKP)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




EDO_A_13(3TIY)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




IMD_B_11(4AU8)
CDK5_HUMAN
[Raw transfer]




BOG_X_3(2FST)
MK14_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(4NST)
CDK12_HUMAN
[Raw transfer]




AF3_A_6(4NST)
CDK12_HUMAN
[Raw transfer]




3 PsiBlast_PDB 94.0699%-115 - C1 -1UNL 7.2 CDK5_HUMAN
1 PsiBlast_PDB 93.6999%-119 - C1 -1UNG 5.2 CDK5_HUMAN
23 PsiBlast_CBE 93.38100%-116 - C1 -4AU8 4.9 CDK5_HUMAN
112 HHSearch 93.07100%-113 - C1 -4AU8 4.9 CDK5_HUMAN
6 PsiBlast_PDB 93.07100%-113 - C1 -4AU8 4.9 CDK5_HUMAN
21 PsiBlast_CBE 91.4499%-125 - C1 -3O0G 6.5 CDK5_HUMAN
94 PsiBlast_CBE 84.6359%-113 - C1 -2VTA 3.1 CDK2_HUMAN
48 PsiBlast_CBE 84.2659%-113 - C1 -3WBL 6.2 CDK2_HUMAN
51 PsiBlast_CBE 84.1759%-116 - C1 -3ULI 7.1 CDK2_HUMAN
83 PsiBlast_CBE 84.1559%-115 - C1 -2VTS 6.3 CDK2_HUMAN
79 PsiBlast_CBE 84.0559%-114 - C1 -2W06 7.3 CDK2_HUMAN
18 PsiBlast_PDB 84.0159%-115 - C1 -1FVT 5.2 CDK2_HUMAN
71 PsiBlast_CBE 83.9059%-114 - C1 -2XNB 7.6 CDK2_HUMAN
59 PsiBlast_CBE 83.7459%-117 - C1 -3LFS 5.6 CDK2_HUMAN
14 PsiBlast_PDB 83.5459%-118 - C1 -1CKP 5.2 CDK2_HUMAN
64 PsiBlast_CBE 83.4959%-112 - C1 -3FZ1 3.8 CDK2_HUMAN
72 PsiBlast_CBE 83.4159%-114 - C1 -2XMY 6.4 CDK2_HUMAN
52 PsiBlast_CBE 83.3659%-117 - C1 -3TIZ 5.2 CDK2_HUMAN
90 PsiBlast_CBE 83.2759%-113 - C1 -2VTL 3.5 CDK2_HUMAN
53 PsiBlast_CBE 83.1659%-116 - C1 -3TIY 3.8 CDK2_HUMAN
61 PsiBlast_CBE 83.1559%-114 - C1 -3LFN 8.0 CDK2_HUMAN
10 PsiBlast_PDB 83.1460%-113 - C1 -1V0P 8.2 CDC2H_PLAFK
77 PsiBlast_CBE 83.1059%-112 - C1 -2W1H 6.7 CDK2_HUMAN
16 PsiBlast_PDB 83.1059%-115 - C1 -1DI8 6.1 CDK2_HUMAN
93 PsiBlast_CBE 83.0359%-116 - C1 -2VTH 3.4 CDK2_HUMAN
58 PsiBlast_CBE 82.9159%-118 - C1 -3NS9 7.5 CDK2_HUMAN
100 PsiBlast_CBE 82.8559%-118 - C1 -2R64 4.8 CDK2_HUMAN
87 PsiBlast_CBE 82.8559%-113 - C1 -2VTO 4.8 CDK2_HUMAN
84 PsiBlast_CBE 82.8459%-113 - C1 -2VTR 5.3 CDK2_HUMAN
45 PsiBlast_CBE 82.7959%-117 - C1 -4D1X 4.9 CDK2_HUMAN
96 PsiBlast_CBE 82.7759%-116 - C1 -2UZO 5.1 CDK2_HUMAN
57 PsiBlast_CBE 82.7159%-115 - C1 -3S2P 4.2 CDK2_HUMAN
28 PsiBlast_CBE 82.7159%-110 - C1 -4LYN 6.4 CDK2_HUMAN
89 PsiBlast_CBE 82.6959%-115 - C1 -2VTM 3.3 CDK2_HUMAN
47 PsiBlast_CBE 82.5359%-116 - C1 -4BGH 5.9 CDK2_HUMAN
60 PsiBlast_CBE 82.4759%-118 - C1 -3LFQ 5.8 CDK2_HUMAN
11 PsiBlast_PDB 82.4559%-114 - C1 -3EZR 6.5 CDK2_HUMAN
95 PsiBlast_CBE 82.4459%-116 - C1 -2V0D 2.4 CDK2_HUMAN
92 PsiBlast_CBE 82.3359%-117 - C1 -2VTI 5.2 CDK2_HUMAN
86 PsiBlast_CBE 82.3259%-116 - C1 -2VTP 4.8 CDK2_HUMAN
80 PsiBlast_CBE 82.2959%-115 - C1 -2W05 7.2 CDK2_HUMAN
12 PsiBlast_PDB 82.2259%-108 - C1 -3EZV 7.1 CDK2_HUMAN
69 PsiBlast_CBE 82.1759%-112 - C1 -3EJ1 5.8 CDK2_HUMAN
97 PsiBlast_CBE 82.1659%-116 - C1 -2UZN 4.5 CDK2_HUMAN
54 PsiBlast_CBE 81.7459%-114 - C1 -3TI1 6.2 CDK2_HUMAN
29 PsiBlast_CBE 81.7459%-113 - C1 -4KD1 8.7 CDK2_HUMAN
19 PsiBlast_PDB 81.6859%-113 - C1 -1FVV 6.4 CDK2_HUMAN
27 PsiBlast_CBE 81.6759%-111 - C1 -5A14 11.1 ?
46 PsiBlast_CBE 81.6659%-113 - C1 -4BZD 7.9 CDK2_HUMAN
49 PsiBlast_CBE 81.5859%-110 - C1 -3UNK 7.1 CDK2_HUMAN
70 PsiBlast_CBE 81.5059%-111 - C1 -3EJ1 5.9 CDK2_HUMAN
50 PsiBlast_CBE 81.4359%-114 - C1 -3UNJ 7.2 CDK2_HUMAN
85 PsiBlast_CBE 81.3059%-112 - C1 -2VTQ 5.6 CDK2_HUMAN
67 PsiBlast_CBE 81.2959%-114 - C1 -3EOC 6.1 CDK2_HUMAN
65 PsiBlast_CBE 81.2659%-113 - C1 -3F5X 8.5 CDK2_HUMAN
99 PsiBlast_CBE 81.1959%-109 - C1 -2UUE 5.4 CDK2_HUMAN
68 PsiBlast_CBE 81.1359%-112 - C1 -3EOC 7.2 CDK2_HUMAN
76 PsiBlast_CBE 80.9959%-110 - C1 -2WEV 6.2 CDK2_HUMAN
30 PsiBlast_CBE 80.9859%-111 - C1 -4FX3 7.0 CDK2_HUMAN
91 PsiBlast_CBE 80.9759%-111 - C1 -2VTJ 4.3 CDK2_HUMAN
75 PsiBlast_CBE 80.8959%-111 - C1 -2WEV 6.4 CDK2_HUMAN
122 HHSearch 80.8559%-109 - C1 -3NIZ 4.3 ?
66 PsiBlast_CBE 80.7959%-113 - C1 -3F5X 7.8 CDK2_HUMAN
13 PsiBlast_PDB 80.7559%-110 - C1 -1FIN 3.8 CDK2_HUMAN
31 PsiBlast_CBE 80.6859%-112 - C1 -4FX3 6.9 CDK2_HUMAN
88 PsiBlast_CBE 80.4659%-110 - C1 -2VTN 4.2 CDK2_HUMAN
98 PsiBlast_CBE 80.3959%-109 - C1 -2UUE 6.2 CDK2_HUMAN
74 PsiBlast_CBE 80.1659%-109 - C1 -2X1N 7.1 CDK2_HUMAN
73 PsiBlast_CBE 80.1259%-109 - C1 -2X1N 6.6 CDK2_HUMAN
25 PsiBlast_CBE 79.6260%-119 - C1 -1V0P 7.5 CDC2H_PLAFK
82 PsiBlast_CBE 79.2459%-108 - C1 -2VU3 6.4 CDK2_HUMAN
26 PsiBlast_CBE 79.2459%-114 - C1 -5D1J 6.7 ?
7 PsiBlast_PDB 79.0560%-110 - C1 -1V0O 6.2 CDC2H_PLAFK
24 PsiBlast_CBE 78.0860%-107 - C1 -1V0O 6.5 CDC2H_PLAFK
132 HHSearch 72.7641% -99 - C1 -4NST 5.3 CDK12_HUMAN
119 HHSearch 72.4341%-100 - C1 -3N9X 2.7 ?
118 HHSearch 71.9136%-106 - C1 -3EB0 6.3 ?
113 HHSearch 70.9146% -96 - C1 -1UA2 5.1 CDK7_HUMAN
130 HHSearch 69.2242%-107 - C1 -4BGQ 7.8 CDKL5_HUMAN
131 HHSearch 68.8042%-111 - C1 -4F6U 9.4 CDK8_HUMAN
124 HHSearch 68.5938%-102 - C1 -4IC7 5.0 MK07_HUMAN
128 HHSearch 63.4836%-103 - C1 -2FST 2.7 MK14_HUMAN
78 PsiBlast_CBE 47.7159% 16 - C1 -2W17 4.4 CDK2_HUMAN
33 PsiBlast_CBE 47.0759% 16 - C1 -4FKV 3.4 CDK2_HUMAN
55 PsiBlast_CBE 46.7459% 15 - C1 -3SW7 3.5 CDK2_HUMAN
34 PsiBlast_CBE 46.6859% 18 - C1 -4FKR 4.1 CDK2_HUMAN
35 PsiBlast_CBE 46.6759% 12 - C1 -4FKQ 5.0 CDK2_HUMAN
42 PsiBlast_CBE 46.5559% 16 - C1 -4EK6 4.5 CDK2_HUMAN
37 PsiBlast_CBE 46.3059% 18 - C1 -4FKO 3.8 CDK2_HUMAN
44 PsiBlast_CBE 46.1059% 19 - C1 -4EK4 1.7 CDK2_HUMAN
62 PsiBlast_CBE 46.0659% 16 - C1 -3IGG 3.2 CDK2_HUMAN
40 PsiBlast_CBE 46.0359% 19 - C1 -4FKG 4.5 CDK2_HUMAN
39 PsiBlast_CBE 45.9659% 16 - C1 -4FKJ 3.3 CDK2_HUMAN
81 PsiBlast_CBE 45.8959% 13 - C1 -2VV9 4.2 CDK2_HUMAN
43 PsiBlast_CBE 45.8759% 17 - C1 -4EK5 3.2 CDK2_HUMAN
63 PsiBlast_CBE 45.8359% 17 - C1 -3IG7 5.0 CDK2_HUMAN
115 HHSearch 45.8060% 19 * C1 *4EK4 1.7 CDK2_HUMAN
32 PsiBlast_CBE 45.6259% 17 - C1 -4FKW 2.1 CDK2_HUMAN