@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 110_tII_WHEAT: (2014-05-01 )
QDCDAGKLIVCAAAIIGGAEPSASCCSNLKAQQGCLCKYASNPAYSGYINSPTARKTLTSCGIPIPTCPQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
12 HHSearch 92.0158%-122 - C2 -1L6H - NLTPX_ORYSJ -
26 SP3 91.6557%-122 - C2 -1L6H - NLTPX_ORYSJ -
1 Fugue 91.6557%-122 - C2 -1L6H - NLTPX_ORYSJ -
11 HHSearch 91.2960%-120 - C2 -1N89 5.1 NLT2G_WHEAT
33 SP3 73.2421%-149 - C2 -1S6D - 2SS8_HELAN -
15 HHSearch 70.0931% -97 - C2 -1SIY - NLTP1_VIGRR -
2 Fugue 69.4729%-103 - C2 -2RKN - DIRL1_ARATH -
13 HHSearch 69.2728%-109 - C2 -2RKN - DIRL1_ARATH -
19 HHSearch 67.3533%-119 - C2 -1T12 - NLTP1_TOBAC -
18 HHSearch 63.6433% -99 - C2 -1AFH - NLTP_MAIZE -
4 Fugue 63.1818%-113 - C2 -1S6D - 2SS8_HELAN -
27 SP3 62.3128% -83 * C2 *1FK5 - NLTP_MAIZE -
21 HHSearch 61.3125%-131 - C2 -1HYP - HPSE_SOYBN -
17 HHSearch 60.5926% -97 - C2 -2ALG - NLTP1_PRUPE -
14 HHSearch 57.9728% -65 - C2 -1BWO - NLTP1_WHEAT -
35 SP3 51.5518%-104 - C2 -1PS6 - PDXA_ECOLI -
30 SP3 50.2522% -67 - C2 -1HYP - ? -
7 Fugue 46.5325% -89 - C2 -1MOL - MONB_DIOCU -
32 SP3 41.8712% -85 - C2 -1ELK - TOM1_HUMAN -
29 SP3 41.2017% -76 - C2 -1KNG - CYCY_BRADU -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
40 93.55100%-128 - C- -M040 - -
41 91.33100%-130 - C- -M041 - -