@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-05 )
ESAISCGTVTSDLTPCVGYLTSGKGKPTPNCCGGVKKLAGLANTTPARRAVCGCLKQAYSQFPNANSAAVSGLPGACGVNLPFKISLQTNCNTIN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
22 HHSearch 93.6647%-141 - C3 -1T12 - NLTP1_TOBAC -
26 HHSearch 92.5848%-138 - C3 -1SIY - NLTP1_VIGRR -
23 HHSearch 90.4547%-133 - C3 -2ALG 3.4 NLTP1_PRUPE
21 HHSearch 87.6241%-114 - C3 -1AFH - NLTP_MAIZE -
11 SP3 87.5340%-127 - C3 -1FK5 - NLTP_MAIZE -
25 HHSearch 84.3539%-126 - C3 -1BWO - NLTP1_WHEAT -
39 HHSearch 60.2618%-134 - C3 -1W2Q - CONG_ARAHY -
36 HHSearch 54.6720%-119 - C3 -1SM7 - ? -
35 HHSearch 53.0716%-135 - C3 -1BEA - ITRF_MAIZE -
33 HHSearch 51.5223%-127 - C3 -3OB4 - ? -
31 HHSearch 49.0521% -85 - C3 -1PSY - 2SS_RICCO -
16 SP3 47.8813%-121 - C3 -1HSS - IAA1_WHEAT -
15 SP3 45.8513% -71 - C3 -1A0P - ? -
27 HHSearch 45.6821% -99 - C3 -2RKN - DIRL1_ARATH -
34 HHSearch 43.8112%-107 - C3 -1B1U - IAAT_ELECO -
2 Fugue 43.5919% -77 - C3 -2RKN - DIRL1_ARATH -
12 SP3 43.2020% -70 - C3 -1L6H - NLTPX_ORYSJ -
19 SP3 42.918%-108 - C3 -1QPO - NADC_MYCTU -
18 SP3 41.928%-108 - C3 -1QPO - NADC_MYCTU -
38 HHSearch 40.8615% -93 - C3 -2LVF - ? -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
41 97.35100%-148 - C- -M041 - -
47 36.21100% 5 - C- -M047 - -
44 35.37100% -1 - C- -M044 - -
46 33.10100% 10 - C- -M046 - -