@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-06 )
LSCSVVASNLAQCLTYLRNGGAVPPACCKGVGTLNNAAKTTQDRRDACNCIKTTAAQLGGVNSNYAAALPGLCHVNIPYKISTSTNCASIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
11 HHSearch 95.3560%-124 - C4 -2ALG 3.9 NLTP1_PRUPE
14 HHSearch 93.8456%-126 - C4 -1SIY - NLTP1_VIGRR -
12 HHSearch 91.9252%-118 - C4 -1T12 - NLTP1_TOBAC -
32 SP3 88.4351%-126 - C4 -1FK5 4.7 NLTP_MAIZE
13 HHSearch 85.0052%-118 - C4 -1AFH - NLTP_MAIZE -
16 HHSearch 82.6437%-130 - C4 -1BWO - NLTP1_WHEAT -
28 HHSearch 63.9923%-146 * C4 *1HSS - IAA1_WHEAT -
25 HHSearch 60.8724%-134 - C4 -1SM7 - ? -
40 SP3 60.2918%-139 - C4 -1HSS - IAA1_WHEAT -
24 HHSearch 58.8617%-138 - C4 -1BEA - ITRF_MAIZE -
30 HHSearch 57.7217% -91 - C4 -1W2Q - CONG_ARAHY -
10 Fugue 52.5523% -74 - C4 -1PSY - 2SS_RICCO -
2 Fugue 52.3621%-109 - C4 -2RKN - DIRL1_ARATH -
8 Fugue 52.0315% -52 - C4 -3EUJ - -
31 HHSearch 52.0121%-111 - C4 -1S6D - 2SS8_HELAN -
23 HHSearch 51.6525% -80 - C4 -1PSY - 2SS_RICCO -
38 SP3 50.6916%-108 - C4 -1QPO - NADC_MYCTU -
17 HHSearch 50.5320%-129 - C4 -2RKN - DIRL1_ARATH -
36 SP3 50.3916%-108 - C4 -1QPO - NADC_MYCTU -
29 HHSearch 49.7120% -89 - C4 -2LVF - ? -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]



OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]
46 96.70100%-133 - C- -M046 - -
42 96.63100%-128 - C- -M042 - -
48 96.56100%-127 - C- -M048 - -
43 95.92100%-139 - C- -M043 - -