@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-08 )
AITCGQVGSSLAPCIPYATGRASALPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVKSVNMGTVATIPGKCGVSVGFPISMSTDCNKIS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
29 SP3 93.8159%-130 - C3 -1FK5 5.9 NLTP_MAIZE
12 HHSearch 93.6457%-144 - C3 -2ALG 3.6 NLTP1_PRUPE
10 HHSearch 90.1559%-130 - C3 -1AFH - NLTP_MAIZE -
11 HHSearch 89.1351%-128 - C3 -1T12 - NLTP1_TOBAC -
14 HHSearch 88.2341%-138 - C3 -1BWO - NLTP1_WHEAT -
15 HHSearch 83.7746%-135 - C3 -1SIY - NLTP1_VIGRR -
22 HHSearch 62.6423%-151 - C3 -1BEA - ITRF_MAIZE -
8 Fugue 59.7621%-108 - C3 -1S6D - 2SS8_HELAN -
23 HHSearch 59.5924%-118 - C3 -1SM7 - ? -
16 HHSearch 53.6521% -92 - C3 -2RKN - DIRL1_ARATH -
2 Fugue 51.7022% -70 - C3 -2RKN - DIRL1_ARATH -
24 HHSearch 50.1122%-105 - C3 -1PSY - 2SS_RICCO -
20 HHSearch 48.2117%-121 - C3 -1B1U - IAAT_ELECO -
25 HHSearch 47.1714%-106 * C3 *3OB4 - ? -
26 HHSearch 46.7319%-121 - C3 -1S6D - 2SS8_HELAN -
34 SP3 46.5512% -74 - C3 -1A0P - ? -
38 SP3 45.7016% -86 - C3 -1B0A - FOLD_ECOLI -
3 Fugue 42.0720% -55 - C3 -1PSY - 2SS_RICCO -
33 SP3 39.0113% -76 - C3 -1A0P - ? -
18 HHSearch 38.6020% -74 - C3 -1N89 - NLT2G_WHEAT -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
41 97.57100%-150 - C- -M041 - -
39 97.09100%-147 - C- -M039 - -
40 93.37100%-144 - C- -M040 - -
45 92.73100%-142 - C- -M045 - -