@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 678_tII_BRADI: (2014-05-13 )
AQCNAGQLIVCAPAIIGGAAPTAACCSNLRAQQGCFCEFARNPAYASYIKSQTARKAIAACRVALPRCP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
20 HHSearch 88.4965%-136 - C3 -1L6H - NLTPX_ORYSJ -
9 SP3 88.4965%-136 - C3 -1L6H - NLTPX_ORYSJ -
1 Fugue 88.4965%-136 - C3 -1L6H - NLTPX_ORYSJ -
19 HHSearch 83.5354%-130 - C3 -1N89 6.2 NLT2G_WHEAT
2 Fugue 73.8426%-112 - C3 -2RKN - DIRL1_ARATH -
21 HHSearch 67.3525%-115 - C3 -2RKN - DIRL1_ARATH -
10 SP3 63.3326% -91 - C3 -1FK5 - NLTP_MAIZE -
26 HHSearch 62.8329%-109 - C3 -1AFH - NLTP_MAIZE -
3 Fugue 61.9515%-152 - C3 -1S6D - 2SS8_HELAN -
24 HHSearch 60.7732%-103 - C3 -2ALG - NLTP1_PRUPE -
22 HHSearch 60.2425% -87 * C3 *1BWO - NLTP1_WHEAT -
27 HHSearch 60.0826%-115 - C3 -1T12 - NLTP1_TOBAC -
23 HHSearch 57.7625%-111 - C3 -1SIY - NLTP1_VIGRR -
11 SP3 55.7615%-125 - C3 -1KNG - CYCY_BRADU -
28 HHSearch 54.9318%-134 - C3 -1HYP - HPSE_SOYBN -
12 SP3 47.908%-110 - C3 -1U78 - TC3A_CAEEL -
13 SP3 47.0517%-118 - C3 -1HYP - ? -
14 SP3 41.817%-118 - C3 -1TC3 - TC3A_CAEEL -
7 Fugue 38.4012% -86 - C3 -3A1Y - RL12_PYRHO -
17 SP3 37.8513% -90 - C3 -1F9M - TRXF_SPIOL -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
39 97.01100%-155 - C- -M039 - -
40 96.06100%-144 - C- -M040 - -
38 95.75100%-143 - C- -M038 - -
41 94.33100%-145 - C- -M041 - -