@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0217: (2015-11-29 )
MKTILAVETSCDETAVAIVNSEKQVLAQEILSQTEHKKRGGVIPEIASRAHMEHLSSLIKNSIEKSNLNFCNLDATAATSGPGLIGGLIVGTMMAKAIAHVTQKPFIAVNHLEAHVLVIRLLYEVKFPFLVLLISGGHCQFLIAQNVGKYIKLGETLDDSLGEAFDKVARMLGLSYPGGPLIEKLAKKGNGTRFKLPRAMRKRPGCNFSFSGIKTAVKNLVQELEMSEQDVCDVCASFQECISEILLDRVKNAVIMAESLNIKINDFVVTGGVAANNFLRKKLKKHINLNILFPPINLCTDNAVMVGWTGIEILQKDYIDSLNFAPRPRWELGSY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AGS_B_10(3ZEU)
?
[Raw transfer]




ATP_B_14(4WQ5)
TSAD_ECOLI
[Raw transfer]




AGS_E_16(3ZEU)
?
[Raw transfer]




ATP_B_9(4WQ4)
TSAD_ECOLI
[Raw transfer]




ATP_A_7(4WQ5)
TSAD_ECOLI
[Raw transfer]




ADP_A_5(4YDU)
TSAD_ECOLI
[Raw transfer]




ADP_B_12(4YDU)
TSAD_ECOLI
[Raw transfer]




AGS_B_10(3ZEU)
?
[Raw transfer]




ATP_A_6(4WQ4)
TSAD_ECOLI
[Raw transfer]




ANP_A_3(2IVN)
KAE1_PYRAB
[Raw transfer]




AMP_B_4(3ZET)
?
[Raw transfer]




ANP_A_3(2IVN)
KAE1_PYRAB
[Raw transfer]




22 PsiBlast_CBE 98.5039%-118 - C2 -3ZEU 6.7 ?
5 PsiBlast_PDB 98.2339%-120 - C2 -4WQ5 6.9 TSAD_ECOLI
4 PsiBlast_PDB 98.0239%-119 - C2 -4WQ4 5.5 TSAD_ECOLI
3 PsiBlast_PDB 97.6539%-117 - C2 -3ZEU 7.5 ?
2 PsiBlast_PDB 97.5339%-117 - C2 -3ZET 6.1 ?
23 PsiBlast_CBE 97.4639%-118 - C2 -4WQ4 6.1 TSAD_ECOLI
1 PsiBlast_PDB 96.9339%-117 - C2 -4YDU 6.2 TSAD_ECOLI
21 PsiBlast_CBE 96.8839%-116 - C2 -4YDU 6.2 TSAD_ECOLI
24 PsiBlast_CBE 96.6539%-115 - C2 -4WQ5 7.8 TSAD_ECOLI
31 HHSearch 95.0337%-112 - C2 -3ZEU 5.4 ?
33 HHSearch 89.4932%-113 - C2 -2IVN 6.2 KAE1_PYRAB
32 HHSearch 88.3332%-121 * C2 *3EN9 - KAE1B_METJA -
26 PsiBlast_CBE 88.3134%-114 - C2 -2IVO - KAE1_PYRAB -
7 PsiBlast_PDB 88.1134%-111 - C2 -2IVN - KAE1_PYRAB -
9 PsiBlast_PDB 87.9134%-113 - C2 -2IVP - KAE1_PYRAB -
25 PsiBlast_CBE 87.8334%-114 - C2 -2IVO - KAE1_PYRAB -
8 PsiBlast_PDB 87.7834%-112 - C2 -2IVO - KAE1_PYRAB -
52 Fugue 87.6032%-103 - C2 -2IVN 7.0 KAE1_PYRAB
27 PsiBlast_CBE 87.1434%-112 - C2 -2IVO - KAE1_PYRAB -
6 PsiBlast_PDB 86.1429%-117 - C2 -3WUH - QRI7_YEAST -