@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1730: (2016-03-28 )
MLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELIYGAKMAWRNSNRCIGRLFWDSLNVIDARDVTDEASFLSSITYHITQATNEGKLKPYITIYAPKDGPKIFNNQLIRYAGYDNCGDPAEKEVTRLANHLGWKGKGTNFDVLPLIYQLPNESVKFYEYPTSLIKEVPIEHNHYPKLRKLNLKWYAVPIISNMDLKIGGIVYPTAPFNGWYMVTEIGVRNFIDDYRYNLLEKVADAFEFDTLKNNSFNKDRALVELNYAVYHSFKKEGVSIVDHLTAAKQFELFERNEAQQGRQVTGKWSWLAPPLSPTLTSNYHHGYDNTVKDPNFFYKKKESNANQCPFHH

Atome Classification :

(106 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EXI_A_5(4UGY)
NOSO_BACSU
[Raw transfer]




1Q6_A_5(4UGC)
NOSO_BACSU
[Raw transfer]




1QE_A_5(4UGM)
NOSO_BACSU
[Raw transfer]




5H4_A_7(4UGX)
NOSO_BACSU
[Raw transfer]




1EV_A_5(4UG7)
NOSO_BACSU
[Raw transfer]




7S9_A_5(4UGK)
NOSO_BACSU
[Raw transfer]




4V4_A_5(4UGH)
NOSO_BACSU
[Raw transfer]




H49_A_5(4UGN)
NOSO_BACSU
[Raw transfer]




7LN_A_5(4UGQ)
NOSO_BACSU
[Raw transfer]




0GD_A_5(4D7J)
NOSO_BACSU
[Raw transfer]




0GD_A_5(4D7I)
NOSO_BACSU
[Raw transfer]




HEM_B_11(1P6M)
NOS3_BOVIN
[Raw transfer]




HAR_A_3(1M7Z)
NOSO_BACSU
[Raw transfer]




ARG_A_2(2AN2)
NOSO_BACSU
[Raw transfer]




HAR_A_10(2FC2)
NOSO_BACSU
[Raw transfer]




ARG_B_4(2FLQ)
?
[Raw transfer]




HEM_A_2(4UGK)
NOSO_BACSU
[Raw transfer]




HEM_A_5(1MJT)
NOSO_STAAU
[Raw transfer]




HEM_A_2(4UQR)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGY)
NOSO_BACSU
[Raw transfer]




HEM_A_4(3E7M)
NOS2_MOUSE
[Raw transfer]




HEM_B_9(7NSE)
NOS3_BOVIN
[Raw transfer]




HEM_B_9(1RS8)
NOS3_BOVIN
[Raw transfer]




HEM_B_8(8NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(2FC1)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGV)
NOSO_BACSU
[Raw transfer]




HEM_B_13(3NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_11(1NSE)
NOS3_BOVIN
[Raw transfer]




HEM_X_2(2FBZ)
NOSO_BACSU
[Raw transfer]




HEM_A_5(2FLQ)
?
[Raw transfer]




HEM_A_2(4D3V)
NOSO_BACSU
[Raw transfer]




HEM_B_11(3DQS)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4D7I)
NOSO_BACSU
[Raw transfer]




HEM_B_13(2HX2)
NOS3_BOVIN
[Raw transfer]




HEM_A_6(6NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGC)
NOSO_BACSU
[Raw transfer]




HEM_B_11(2G6O)
NOS3_BOVIN
[Raw transfer]




HEM_A_10(2HX2)
NOS3_BOVIN
[Raw transfer]




HEM_B_6(2FLQ)
?
[Raw transfer]




HEM_A_5(2FLQ)
?
[Raw transfer]




HEM_A_2(4UGN)
NOSO_BACSU
[Raw transfer]




HEM_A_8(1RS9)
NOS3_BOVIN
[Raw transfer]




HEM_A_3(2AN2)
NOSO_BACSU
[Raw transfer]




HEM_A_4(8NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_8(2G6O)
NOS3_BOVIN
[Raw transfer]




HEM_A_11(3NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_10(4NSE)
NOS3_BOVIN
[Raw transfer]




HEM_B_11(4NSE)
NOS3_BOVIN
[Raw transfer]




HEM_B_9(2FC2)
NOSO_BACSU
[Raw transfer]




HEM_B_4(2AMO)
NOSO_BACSU
[Raw transfer]




HEM_A_6(7NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_3(1M7V)
NOSO_BACSU
[Raw transfer]




HEM_A_6(5NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_6(1ED5)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGJ)
NOSO_BACSU
[Raw transfer]




HEM_A_2(2AN0)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UG8)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGO)
NOSO_BACSU
[Raw transfer]




HEM_B_9(3NLT)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGR)
NOSO_BACSU
[Raw transfer]




HEM_B_9(5NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_8(1P6M)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGH)
NOSO_BACSU
[Raw transfer]




HEM_A_3(2FC2)
NOSO_BACSU
[Raw transfer]




HEM_A_2(1M7Z)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGP)
NOSO_BACSU
[Raw transfer]




HEM_A_8(1P6N)
NOS3_BOVIN
[Raw transfer]




HEM_A_8(1RS8)
NOS3_BOVIN
[Raw transfer]




NAD_A_7(1MJT)
NOSO_STAAU
[Raw transfer]




HEM_A_3(3NLT)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGM)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D7H)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGU)
NOSO_BACSU
[Raw transfer]




HEM_B_11(1P6N)
NOS3_BOVIN
[Raw transfer]




HEM_B_11(1P6L)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGI)
NOSO_BACSU
[Raw transfer]




HEM_B_12(9NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_8(1D0C)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4D7J)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGA)
NOSO_BACSU
[Raw transfer]




HEM_B_9(6NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_8(9NSE)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGT)
NOSO_BACSU
[Raw transfer]




HEM_A_8(3DQS)
NOS3_BOVIN
[Raw transfer]




HEM_A_8(1P6L)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UQS)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGX)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UG7)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGL)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGQ)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3M)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3O)
NOSO_BACSU
[Raw transfer]




HEM_B_10(3PNH)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4LWB)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3U)
NOSO_BACSU
[Raw transfer]




HEM_A_3(3PNH)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UGG)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3J)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGE)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3I)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3T)
NOSO_BACSU
[Raw transfer]




HEM_B_7(4D3K)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UG9)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGD)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGS)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3N)
NOSO_BACSU
[Raw transfer]




HEM_A_3(2AMO)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGB)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UG5)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGF)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4LWA)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGW)
NOSO_BACSU
[Raw transfer]




HEM_A_3(3NLU)
NOS3_BOVIN
[Raw transfer]




HEM_A_3(4D3K)
NOSO_BACSU
[Raw transfer]




HEM_B_11(1RS9)
NOS3_BOVIN
[Raw transfer]




HEC_A_4(3E7S)
NOS3_BOVIN
[Raw transfer]




HEM_A_8(3DQT)
NOS3_BOVIN
[Raw transfer]




HEM_B_11(3DQT)
NOS3_BOVIN
[Raw transfer]




HEM_A_2(4UG6)
NOSO_BACSU
[Raw transfer]




H4B_A_3(4UQR)
NOSO_BACSU
[Raw transfer]




HEM_B_10(3NLU)
NOS3_BOVIN
[Raw transfer]




NAD_A_7(1MJT)
NOSO_STAAU
[Raw transfer]




H4B_A_3(4UGP)
NOSO_BACSU
[Raw transfer]




109 HHSearch 98.96100%-107 - C9 -1MJT 2.9 NOSO_STAAU
21 PsiBlast_CBE 98.80100%-109 - C9 -1MJT 2.6 NOSO_STAAU
1 PsiBlast_PDB 98.77100%-107 - C9 -1MJT 11.8 NOSO_STAAU
12 PsiBlast_PDB 88.4152% -96 - C9 -4UQS 10.9 NOSO_BACSU
8 PsiBlast_PDB 88.2652% -95 - C9 -4D3U 12.0 NOSO_BACSU
3 PsiBlast_PDB 88.2453% -98 - C9 -1M7Z 11.8 NOSO_BACSU
24 PsiBlast_CBE 88.2252% -93 - C9 -4UGY 12.0 NOSO_BACSU
34 PsiBlast_CBE 88.2052% -93 - C9 -4UGM 11.9 NOSO_BACSU
50 PsiBlast_CBE 88.1052% -98 - C9 -4UG6 11.5 NOSO_BACSU
110 HHSearch 88.0756% -98 - C9 -2FLQ 11.5 ?
7 PsiBlast_PDB 88.0752% -95 - C9 -2FC2 11.7 NOSO_BACSU
11 PsiBlast_PDB 88.0552% -93 - C9 -4UQR 11.8 NOSO_BACSU
25 PsiBlast_CBE 88.0052% -94 - C9 -4UGX 11.8 NOSO_BACSU
4 PsiBlast_PDB 88.0053% -95 - C9 -2FC1 11.9 NOSO_BACSU
15 PsiBlast_PDB 87.9552% -96 - C9 -4D3K 12.0 NOSO_BACSU
23 PsiBlast_CBE 87.9352% -93 - C9 -2FC2 11.5 NOSO_BACSU
53 PsiBlast_CBE 87.9252% -94 - C9 -4D3K 12.0 NOSO_BACSU
16 PsiBlast_PDB 87.9052% -94 - C9 -4D3M 11.9 NOSO_BACSU
55 PsiBlast_CBE 87.8852% -94 - C9 -4D7I 11.8 NOSO_BACSU
31 PsiBlast_CBE 87.8752% -91 - C9 -4UGP 12.1 NOSO_BACSU
35 PsiBlast_CBE 87.8352% -95 - C9 -4UGL 11.8 NOSO_BACSU
36 PsiBlast_CBE 87.8152% -93 - C9 -4UGK 11.9 NOSO_BACSU
14 PsiBlast_PDB 87.7952% -94 - C9 -4D3J 11.8 NOSO_BACSU
6 PsiBlast_PDB 87.7952%-100 - C9 -1M7V 12.0 NOSO_BACSU
41 PsiBlast_CBE 87.7752% -94 - C9 -4UGF 11.5 NOSO_BACSU
33 PsiBlast_CBE 87.7652% -93 - C9 -4UGN 11.9 NOSO_BACSU
9 PsiBlast_PDB 87.7652% -94 - C9 -4LWA 11.8 NOSO_BACSU
52 PsiBlast_CBE 87.7452% -93 - C9 -4D7H 12.0 NOSO_BACSU
46 PsiBlast_CBE 87.7252% -93 - C9 -4UGA 11.8 NOSO_BACSU
56 PsiBlast_CBE 87.7152% -98 - C9 -2AN0 11.4 NOSO_BACSU
40 PsiBlast_CBE 87.7052% -92 - C9 -4UGG 11.6 NOSO_BACSU
51 PsiBlast_CBE 87.6952% -94 - C9 -4D7J 11.6 NOSO_BACSU
38 PsiBlast_CBE 87.6952% -96 - C9 -4UGI 11.9 NOSO_BACSU
13 PsiBlast_PDB 87.6952% -94 - C9 -4D3I 11.9 NOSO_BACSU
44 PsiBlast_CBE 87.6552% -93 - C9 -4UGC 11.8 NOSO_BACSU
37 PsiBlast_CBE 87.6552% -93 - C9 -4UGJ 11.9 NOSO_BACSU
27 PsiBlast_CBE 87.6452% -95 - C9 -4UGT 11.8 NOSO_BACSU
2 PsiBlast_PDB 87.6356% -98 - C9 -2FLQ 11.5 ?
48 PsiBlast_CBE 87.6252% -93 - C9 -4UG8 11.9 NOSO_BACSU
54 PsiBlast_CBE 87.5652% -94 - C9 -4D3V 12.1 NOSO_BACSU
28 PsiBlast_CBE 87.5652% -94 - C9 -4UGS 11.8 NOSO_BACSU
29 PsiBlast_CBE 87.5452% -92 - C9 -4UGR 12.0 NOSO_BACSU
42 PsiBlast_CBE 87.4952% -94 - C9 -4UGE 11.7 NOSO_BACSU
49 PsiBlast_CBE 87.4752% -94 - C9 -4UG7 11.6 NOSO_BACSU
19 PsiBlast_PDB 87.4652% -92 - C9 -4D3T 12.0 NOSO_BACSU
30 PsiBlast_CBE 87.4452% -94 - C9 -4UGQ 12.0 NOSO_BACSU
60 PsiBlast_CBE 87.3752% -94 - C9 -4UGV 11.8 NOSO_BACSU
45 PsiBlast_CBE 87.3752% -93 - C9 -4UGB 11.8 NOSO_BACSU
47 PsiBlast_CBE 87.3052% -94 - C9 -4UG9 12.0 NOSO_BACSU
26 PsiBlast_CBE 87.2852% -94 - C9 -4UGU 12.0 NOSO_BACSU
5 PsiBlast_PDB 87.2552% -94 - C9 -2FBZ 11.8 NOSO_BACSU
17 PsiBlast_PDB 87.2452% -93 - C9 -4D3N 11.9 NOSO_BACSU
32 PsiBlast_CBE 87.2152% -93 - C9 -4UGO 11.8 NOSO_BACSU
58 PsiBlast_CBE 87.1952% -95 - C9 -2AMO 11.3 NOSO_BACSU
20 PsiBlast_PDB 87.1752% -93 - C9 -4UG5 11.7 NOSO_BACSU
59 PsiBlast_CBE 87.1652% -94 - C9 -4UGW 11.4 NOSO_BACSU
61 PsiBlast_CBE 87.1452% -97 - C9 -2AN2 11.6 NOSO_BACSU
10 PsiBlast_PDB 87.1352% -94 - C9 -4LWB 11.8 NOSO_BACSU
18 PsiBlast_PDB 87.0752% -93 - C9 -4D3O 12.2 NOSO_BACSU
39 PsiBlast_CBE 87.0352% -94 - C9 -4UGH 11.9 NOSO_BACSU
43 PsiBlast_CBE 86.9452% -94 - C9 -4UGD 11.8 NOSO_BACSU
22 PsiBlast_CBE 86.7556% -96 - C9 -2FLQ 11.8 ?
57 PsiBlast_CBE 85.0052% -87 - C9 -2AMO 11.7 NOSO_BACSU
113 HHSearch 84.9443% -88 * C9 *1D0C 12.1 NOS3_BOVIN
97 PsiBlast_CBE 84.7042% -91 - C9 -3NLU 11.4 NOS3_BOVIN
102 Fugue 84.4342% -88 - C9 -1NSE 12.0 NOS3_BOVIN
101 Fugue 84.3842% -89 - C9 -1ED5 11.8 NOS3_BOVIN
95 PsiBlast_CBE 84.2642% -91 - C9 -3NSE 11.6 NOS3_BOVIN
99 PsiBlast_CBE 84.2542% -90 - C9 -3NLT 11.7 NOS3_BOVIN
89 PsiBlast_CBE 84.1142% -88 - C9 -6NSE 11.7 NOS3_BOVIN
100 PsiBlast_CBE 84.0942% -92 - C9 -3NLT 11.9 NOS3_BOVIN
70 PsiBlast_CBE 84.0842% -93 - C9 -3PNH 11.4 NOS3_BOVIN
83 PsiBlast_CBE 84.0742% -89 - C9 -9NSE 11.7 NOS3_BOVIN
96 PsiBlast_CBE 83.9842% -92 - C9 -3NSE 12.0 NOS3_BOVIN
92 PsiBlast_CBE 83.9442% -91 - C9 -5NSE 11.7 NOS3_BOVIN
79 PsiBlast_CBE 83.9442% -92 - C9 -1RS9 11.5 NOS3_BOVIN
76 PsiBlast_CBE 83.8942% -94 - C9 -2HX2 11.9 NOS3_BOVIN
80 PsiBlast_CBE 83.8642% -94 - C9 -1RS9 11.7 NOS3_BOVIN
65 PsiBlast_CBE 83.8542% -93 - C9 -1P6M 12.0 NOS3_BOVIN
94 PsiBlast_CBE 83.8142% -92 - C9 -4NSE 11.7 NOS3_BOVIN
77 PsiBlast_CBE 83.7942% -91 - C9 -2G6O 12.0 NOS3_BOVIN
87 PsiBlast_CBE 83.7742% -91 - C9 -7NSE 11.8 NOS3_BOVIN
73 PsiBlast_CBE 83.7742% -90 - C9 -3DQS 11.7 NOS3_BOVIN
112 HHSearch 83.6942% -89 - C9 -3E7M 11.8 NOS2_MOUSE
71 PsiBlast_CBE 83.6942% -88 - C9 -3DQT 11.7 NOS3_BOVIN
90 PsiBlast_CBE 83.6742% -92 - C9 -6NSE 11.9 NOS3_BOVIN
82 PsiBlast_CBE 83.6842% -90 - C9 -1RS8 11.7 NOS3_BOVIN