@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00420: (2016-06-01 )
MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDTNILNRIVDHAEVTEKTGVIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILKDTLSPYENVTVIHQDVLKADVKSVIEEQFQDCDEIMVVANLPYYVTTPIIMKLLEEHLPLKGIVVMLQKEVAERMAADPSSKEYGSLSIAVQFYTEAKTVMIVPKTVFVPQPNVDSAVIRLILRDGPAVDVENESFFFQLIKASFAQRRKTLLNNLVNNLPEGKAQKSTIEQVLEETNIDGKRRGESLSIEEFAALSNGLYKALF

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAM_D_4(1ZQ9)
DIM1_HUMAN
[Raw transfer]




SAM_C_3(1ZQ9)
DIM1_HUMAN
[Raw transfer]




SAM_C_3(1ZQ9)
DIM1_HUMAN
[Raw transfer]




MTA_C_6(3FUX)
RSMA_THET8
[Raw transfer]




SAM_C_3(1ZQ9)
DIM1_HUMAN
[Raw transfer]




MTA_B_5(3FUX)
RSMA_THET8
[Raw transfer]




SAH_A_4(3FTF)
RSMA_AQUAE
[Raw transfer]




AMP_A_2(3GRU)
RSMA_METJA
[Raw transfer]




8 PsiBlast_PDB 93.9437%-126 - C1 -3FYC - RSMA_METJA -
23 PsiBlast_CBE 93.0137%-122 - C1 -3FYC - RSMA_METJA -
3 PsiBlast_PDB 92.8837%-122 - C1 -3GRV - RSMA_METJA -
7 PsiBlast_PDB 92.6835%-118 - C1 -3FUX - RSMA_THET8 -
22 PsiBlast_CBE 92.5135%-119 - C1 -3FUX 6.2 RSMA_THET8
49 HHSearch 92.3438%-115 - C1 -3GRU 5.3 RSMA_METJA
4 PsiBlast_PDB 92.2237%-124 - C1 -3GRY - RSMA_METJA -
2 PsiBlast_PDB 92.1037%-121 - C1 -3GRU - RSMA_METJA -
9 PsiBlast_PDB 91.7937%-121 - C1 -3FYD - RSMA_METJA -
1 PsiBlast_PDB 91.3637%-118 - C1 -3GRR - RSMA_METJA -
21 PsiBlast_CBE 91.0035%-120 - C1 -3FUX 6.0 RSMA_THET8
6 PsiBlast_PDB 90.9335%-117 - C1 -3FUW - RSMA_THET8 -
25 PsiBlast_CBE 90.8331%-116 - C1 -1ZQ9 7.4 DIM1_HUMAN
16 PsiBlast_PDB 90.8031%-117 - C1 -1ZQ9 4.1 DIM1_HUMAN
5 PsiBlast_PDB 90.1935%-118 - C1 -3FUU - RSMA_THET8 -
50 HHSearch 89.5133%-113 * C1 *1ZQ9 4.1 DIM1_HUMAN
33 Fugue 86.8731%-115 - C1 -1ZQ9 4.1 DIM1_HUMAN
11 PsiBlast_PDB 85.8231%-126 - C1 -4JXJ - RSMA_RICBR -
14 PsiBlast_PDB 84.8832%-119 - C1 -4ADV - RSMA_ECOLI -
13 PsiBlast_PDB 84.4732%-119 - C1 -1QYR - RSMA_ECOLI -
27 PsiBlast_CBE 77.1933%-123 - C1 -3FTF 7.0 RSMA_AQUAE