@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03000: (2016-06-05 )
MLKKIIGIGVSAMLALSLAACGSENDENASAAEQVNKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQYMKNVNSIEDLKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BET_B_2(2B4L)
OPUAC_BACSU
[Raw transfer]




BET_B_2(2B4L)
OPUAC_BACSU
[Raw transfer]




313_C_7(3CHG)
OPUAC_BACSU
[Raw transfer]




PBE_C_3(2B4M)
OPUAC_BACSU
[Raw transfer]




313_A_8(3CHG)
OPUAC_BACSU
[Raw transfer]




313_D_5(3CHG)
OPUAC_BACSU
[Raw transfer]




PBE_D_4(2B4M)
OPUAC_BACSU
[Raw transfer]




313_B_6(3CHG)
OPUAC_BACSU
[Raw transfer]




BET_A_2(3L6H)
?
[Raw transfer]




2 PsiBlast_PDB 88.35100% -91 - C2 -2B4M 4.3 OPUAC_BACSU
21 PsiBlast_CBE 87.97100% -91 - C2 -2B4M 4.0 OPUAC_BACSU
45 Fugue 87.43100% -85 - C2 -2B4L - OPUAC_BACSU -
1 PsiBlast_PDB 87.43100% -85 - C2 -2B4L 3.7 OPUAC_BACSU
25 HHSearch 87.09100% -86 - C2 -2B4L 3.7 OPUAC_BACSU
19 PsiBlast_CBE 85.20100% -87 - C2 -3CHG 3.2 OPUAC_BACSU
20 PsiBlast_CBE 85.18100% -90 - C2 -3CHG 3.8 OPUAC_BACSU
3 PsiBlast_PDB 84.30100% -84 - C2 -3CHG 3.6 OPUAC_BACSU
18 PsiBlast_CBE 83.83100% -81 - C2 -3CHG 3.8 OPUAC_BACSU
22 PsiBlast_CBE 56.7033%-121 - C2 -3TMG - ? -
23 PsiBlast_CBE 54.8533%-113 - C2 -3TMG - ? -
24 PsiBlast_CBE 54.0533%-107 - C2 -3TMG - ? -
6 PsiBlast_PDB 52.9233%-103 - C2 -3TMG - ? -
5 PsiBlast_PDB 50.2445% -92 - C2 -3L6H 2.3 ?
4 PsiBlast_PDB 49.5945% -76 - C2 -3L6G - ? -
27 HHSearch 49.5332% -89 - C2 -3TMG - ? -
10 PsiBlast_PDB 49.1029% -92 - C2 -2RIN - ? -
7 PsiBlast_PDB 48.0529% -93 - C2 -2REG - ? -
46 Fugue 47.9318% -89 - C2 -1R9L - PROX_ECOLI -
12 PsiBlast_PDB 47.1325%-142 - C2 -1R9L - PROX_ECOLI -