@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu05930: (2016-06-09 )
MKTKAAVRNMRLEDIDHVYEIEASSFTSPWTKDSFYHELLENPYAHYLVIEKDGHLAGYCGIWIVMDDAQITNIAIKPEYRGQSLGETLFRSAVELCKEKDARRLSLEVRVSNHPAQGLYKKFGMQPGGIRKNYYTDNGEDALIMWVTINE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_8(2CNT)
?
[Raw transfer]




GOL_D_13(2CNT)
?
[Raw transfer]




GOL_A_6(2CNT)
?
[Raw transfer]




GOL_C_11(2CNT)
?
[Raw transfer]




CHAIN_E_5(2CNM)
?
[Raw transfer]

-

CHAIN_F_6(2CNM)
?
[Raw transfer]

-

CHAIN_D_4(2CNM)
?
[Raw transfer]

-

99 HHSearch 82.2230%-151 - C1 -4R3L - Y209_SULSO -
97 HHSearch 81.6928%-157 * C1 *2CNT - ? -
7 PsiBlast_PDB 81.4930%-152 - C1 -5C88 - Y209_SULSO -
4 PsiBlast_PDB 80.9130%-156 - C1 -4LX9 - Y209_SULSO -
9 PsiBlast_PDB 80.3828%-159 - C1 -4PV6 - ? -
5 PsiBlast_PDB 79.3830%-152 - C1 -4R3K - Y209_SULSO -
8 PsiBlast_PDB 79.2930%-151 - C1 -2X7B - Y209_SULSO -
6 PsiBlast_PDB 78.9230%-150 - C1 -4R3L - Y209_SULSO -
27 PsiBlast_CBE 78.2331%-161 - C1 -2CNM 4.9 ?
1 PsiBlast_PDB 78.0831%-153 - C1 -2CNM 6.8 ?
24 PsiBlast_CBE 78.0431%-160 - C1 -2CNS - ? -
2 PsiBlast_PDB 78.0231%-155 - C1 -2CNS - ? -
22 PsiBlast_CBE 77.6731%-155 - C1 -2CNT 2.0 ?
23 PsiBlast_CBE 77.3231%-153 - C1 -2CNT 1.8 ?
26 PsiBlast_CBE 77.1731%-166 - C1 -2CNM 5.6 ?
107 HHSearch 77.0626%-172 - C1 -4PV6 - ? -
25 PsiBlast_CBE 76.8831%-153 - C1 -2CNS - ? -
3 PsiBlast_PDB 76.1631%-150 - C1 -2CNT 2.0 ?
21 PsiBlast_CBE 75.5331%-150 - C1 -2CNT 2.1 ?
10 PsiBlast_PDB 75.2430%-176 - C1 -1TIQ - PAIA_BACSU -