@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu06520: (2016-06-10 )
MTIKRALISVSDKTNLVPFVKELTELGVEVISTGGTKKLLQENGVDVIGISEVTGFPEIMDGRLKTLHPNIHGGLLAVRGNEEHMAQINEHGIQPIDLVVVNLYPFKETISKEDVTYEEAIENIDIGGPGMLRAASKNHQDVTVIVDPADYSPVLNQIKEEGSVSLQKKRELAAKVFRHTAAYDALIADYLTNVVGEKEPEQFTVTFEKKQSLRYGENPHQEATFYQTALPVKGSIAQAEQLHGKELSYNNIKDADAAVQIVREFTEPAAVAVKHMNPCGVGTGKTIAEAFDRAFEADKTSIFGGIIALNREVDKATAEALHNIFLEIIIAPSFSQEALDVLTAKKNLRLLTLDVSAAVQKEKQLTSVQGGLLIQDLDMHGFDDAEISIPTKREPNEQEWEDLKLAWKVVKHVKSNAIVLAKDNMTVGVGAGQMNRVGSAKIAIEQAGEKAKGSALGSDAYFPMPDTVEEAAKAGVTAIIQPGGSIRDEDSIKKADEYGIAMVFTGIRHFKH

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

XMP_H_8(1M9N)
PUR9_CHICK
[Raw transfer]




XMP_G_7(1M9N)
PUR9_CHICK
[Raw transfer]




93A_F_6(2B1I)
PUR9_CHICK
[Raw transfer]




XMP_I_9(1P4R)
PUR9_HUMAN
[Raw transfer]




G_A_5(1G8M)
PUR9_CHICK
[Raw transfer]




G_A_5(1G8M)
PUR9_CHICK
[Raw transfer]




93A_E_5(2B1I)
PUR9_CHICK
[Raw transfer]




JLN_A_5(3ZZM)
PUR9_MYCTU
[Raw transfer]




JLN_A_5(3ZZM)
PUR9_MYCTU
[Raw transfer]




JLN_A_7(4A1O)
PUR9_MYCTU
[Raw transfer]




BTB_A_3(4EHI)
PUR9_CAMJE
[Raw transfer]




BTB_A_3(4EHI)
PUR9_CAMJE
[Raw transfer]




203_B_5(2IU3)
PUR9_CHICK
[Raw transfer]




203_B_5(2IU0)
PUR9_CHICK
[Raw transfer]




2 PsiBlast_PDB 81.9943%-106 - C12 -4A1O 5.9 PUR9_MYCTU
22 PsiBlast_CBE 81.7543%-106 - C12 -3ZZM - PUR9_MYCTU -
1 PsiBlast_PDB 81.5643%-101 - C12 -3ZZM 6.6 PUR9_MYCTU
21 PsiBlast_CBE 81.0243%-104 - C12 -4A1O - PUR9_MYCTU -
40 HHSearch 79.4944% -97 * C12 *3ZZM 6.6 PUR9_MYCTU
42 HHSearch 78.8339% -88 - C12 -1G8M 9.4 PUR9_CHICK
41 HHSearch 71.1642% -97 - C12 -4EHI 2.7 PUR9_CAMJE
15 PsiBlast_PDB 71.1436% -94 - C12 -1G8M 9.4 PUR9_CHICK
36 PsiBlast_CBE 71.1136% -97 - C12 -2B1G - PUR9_CHICK -
32 PsiBlast_CBE 70.6736%-102 - C12 -2IU0 3.7 PUR9_CHICK
10 PsiBlast_PDB 70.4736% -93 - C12 -2B1I 7.5 PUR9_CHICK
37 PsiBlast_CBE 70.2036% -97 - C12 -1THZ - PUR9_CHICK -
14 PsiBlast_PDB 70.1236% -96 - C12 -1OZ0 - PUR9_CHICK -
35 PsiBlast_CBE 70.0836% -97 - C12 -2B1G - PUR9_CHICK -
9 PsiBlast_PDB 69.8936% -98 - C12 -2B1G - PUR9_CHICK -
31 PsiBlast_CBE 69.5336% -96 - C12 -2IU3 3.8 PUR9_CHICK
26 PsiBlast_CBE 69.4336% -95 - C12 -1PL0 - PUR9_HUMAN -
13 PsiBlast_PDB 69.1536% -93 - C12 -1M9N 7.6 PUR9_CHICK
38 PsiBlast_CBE 69.1236% -94 - C12 -1OZ0 - PUR9_CHICK -
33 PsiBlast_CBE 69.0936% -96 - C12 -2B1I 8.4 PUR9_CHICK
39 PsiBlast_CBE 68.9536% -95 - C12 -1M9N 8.6 PUR9_CHICK
6 PsiBlast_PDB 68.6836% -94 - C12 -1P4R 8.6 PUR9_HUMAN
3 PsiBlast_PDB 68.3040% -92 - C12 -4EHI 2.7 PUR9_CAMJE