@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14510: (2016-06-22 )
MKKEFAVIGLGRFGGSICKALSEEGVEVMAMDIDEDKVNEYAKIASHAVIGDSTDESVLKNLGLRNFDHVIVAIGENIQASILTTLILKELGVHTITVKAQNDYHEKVLSKIGADHIVHPERDMAKRIAHNIVSNNVLDYLELSEEHSLVEIVANSRLAGNTLLDLDIRAKYGINIVAIKRGKEVIVSPLATEVIHQEDILIVIGSVTDISRFEKRVLHTK

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_D_4(1LSU)
KTRA_BACSU
[Raw transfer]




ADP_A_5(4J91)
KTRA_BACSU
[Raw transfer]




ATP_B_4(4J90)
KTRA_BACSU
[Raw transfer]




NAI_J_10(2HMS)
KTRA_BACSU
[Raw transfer]




NAI_C_3(1LSU)
KTRA_BACSU
[Raw transfer]




ADP_B_6(4J91)
KTRA_BACSU
[Raw transfer]




ATP_B_4(4J90)
KTRA_BACSU
[Raw transfer]




NAI_L_12(2HMS)
KTRA_BACSU
[Raw transfer]




ATP_M_13(2HMU)
KTRA_BACSU
[Raw transfer]




ADP_B_6(4J91)
KTRA_BACSU
[Raw transfer]




NAI_D_4(1LSU)
KTRA_BACSU
[Raw transfer]




ATP_M_13(2HMW)
KTRA_BACSU
[Raw transfer]




ADP_B_6(4J91)
KTRA_BACSU
[Raw transfer]




ADP_D_8(4J91)
KTRA_BACSU
[Raw transfer]




ATP_M_13(2HMW)
KTRA_BACSU
[Raw transfer]




NAI_I_9(2HMT)
KTRA_BACSU
[Raw transfer]




NAI_I_9(2HMT)
KTRA_BACSU
[Raw transfer]




ATP_M_13(2HMU)
KTRA_BACSU
[Raw transfer]




ADP_I_9(2HMV)
KTRA_BACSU
[Raw transfer]




NAI_L_12(2HMS)
KTRA_BACSU
[Raw transfer]




NAI_J_10(2HMS)
KTRA_BACSU
[Raw transfer]




NAI_D_4(1LSU)
KTRA_BACSU
[Raw transfer]




NAI_M_13(2HMT)
KTRA_BACSU
[Raw transfer]




ADP_M_13(2HMV)
KTRA_BACSU
[Raw transfer]




22 PsiBlast_CBE 93.6056%-167 - C2 -4J91 7.1 KTRA_BACSU
23 PsiBlast_CBE 93.2056%-157 - C2 -4J90 7.9 KTRA_BACSU
30 PsiBlast_CBE 92.1855%-155 - C2 -4J7C - KTRA_BACSU -
25 PsiBlast_CBE 92.0555%-157 - C2 -4J7C - KTRA_BACSU -
1 PsiBlast_PDB 91.9956%-152 - C2 -4J90 Error KTRA_BACSU
28 PsiBlast_CBE 91.9855%-156 - C2 -4J7C - KTRA_BACSU -
3 PsiBlast_PDB 91.9255%-157 - C2 -4J7C - KTRA_BACSU -
24 PsiBlast_CBE 91.8455%-155 - C2 -4J7C - KTRA_BACSU -
27 PsiBlast_CBE 91.7955%-159 - C2 -4J7C - KTRA_BACSU -
26 PsiBlast_CBE 91.6155%-153 - C2 -4J7C - KTRA_BACSU -
87 HHSearch 91.4755%-182 - C2 -4J91 Error KTRA_BACSU
21 PsiBlast_CBE 91.3256%-170 - C2 -4J91 7.0 KTRA_BACSU
29 PsiBlast_CBE 91.2355%-152 - C2 -4J7C - KTRA_BACSU -
2 PsiBlast_PDB 90.3056%-182 - C2 -4J91 Error KTRA_BACSU
33 PsiBlast_CBE 77.6363%-173 - C2 -2HMU 6.0 KTRA_BACSU
5 PsiBlast_PDB 77.5463%-173 - C2 -2HMS Error KTRA_BACSU
34 PsiBlast_CBE 76.6963%-166 - C2 -2HMT 6.1 KTRA_BACSU
32 PsiBlast_CBE 76.2663%-172 - C2 -2HMV 6.0 KTRA_BACSU
9 PsiBlast_PDB 75.9863%-174 - C2 -2HMW Error KTRA_BACSU
6 PsiBlast_PDB 75.9463%-168 - C2 -2HMT 6.3 KTRA_BACSU
36 PsiBlast_CBE 75.8763%-170 - C2 -2HMS Error KTRA_BACSU
35 PsiBlast_CBE 75.8563%-167 - C2 -2HMS 7.2 KTRA_BACSU
37 PsiBlast_CBE 75.4563%-167 - C2 -2HMS 7.2 KTRA_BACSU
8 PsiBlast_PDB 75.3863%-169 - C2 -2HMV 6.2 KTRA_BACSU
108 HHSearch 75.3463%-164 - C2 -2HMT 6.3 KTRA_BACSU
7 PsiBlast_PDB 75.3363%-167 - C2 -2HMU Error KTRA_BACSU
31 PsiBlast_CBE 75.1063%-169 - C2 -2HMW 6.2 KTRA_BACSU
112 Fugue 74.6763%-163 - C2 -1LSU Error KTRA_BACSU
10 PsiBlast_PDB 74.6763%-163 - C2 -1LSU Error KTRA_BACSU
38 PsiBlast_CBE 74.2763%-162 - C2 -1LSU 7.1 KTRA_BACSU