@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15140: (2016-06-23 )
MFQHKTVLLRETVDGLNIKPDGTYVDCTLGGAGHSTYLLQQLSEKGRLIAFDQDDTALQHAKEVLSDYKGQLILIKSNFRYLKEYLNEQGVTEVDGILFDLGVSSPQLDTPERGFSYHHDAPLDMRMDQSATLSAKEVVNEWRYEDLVRIFFKYGEEKFSKQIARKIEEARMKSPIQTTGQLVDLIKDAIPAPARRSGGHPAKRVFQAIRIAVNDELRVFEEALEQAIEVLKPGGRVSVITFHSLEDRICKTTFKEKSSLPELPPGLPVIPEEFEPELKLITRKPITASQEELEENNRARSAKLRIAEKRK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAM_D_4(1WG8)
RSMH_THET8
[Raw transfer]




SAM_A_5(1N2X)
RSMH_THEMA
[Raw transfer]




SAM_A_2(3TKA)
RSMH_ECOLI
[Raw transfer]




SAM_C_3(1WG8)
RSMH_THET8
[Raw transfer]




SAM_A_2(3TKA)
RSMH_ECOLI
[Raw transfer]




SAM_D_4(1WG8)
RSMH_THET8
[Raw transfer]




SAH_A_5(1M6Y)
RSMH_THEMA
[Raw transfer]




SAH_A_5(1M6Y)
RSMH_THEMA
[Raw transfer]




2 PsiBlast_PDB 76.9547% -90 - C3 -1WG8 9.8 RSMH_THET8
21 PsiBlast_CBE 76.9247% -92 - C3 -1WG8 9.3 RSMH_THET8
56 HHSearch 76.8052% -87 - C3 -1WG8 9.8 RSMH_THET8
55 HHSearch 75.7244% -85 * C3 *1M6Y 4.7 RSMH_THEMA
1 PsiBlast_PDB 75.5445% -78 - C3 -3TKA 8.9 RSMH_ECOLI
54 HHSearch 75.1347% -75 - C3 -3TKA 8.9 RSMH_ECOLI
3 PsiBlast_PDB 74.0141% -87 - C3 -1M6Y 4.7 RSMH_THEMA
4 PsiBlast_PDB 73.9341% -85 - C3 -1N2X 6.4 RSMH_THEMA
5 PsiBlast_PDB 49.8027%-125 - C3 -3EEY - ? -
60 HHSearch 46.1218%-126 - C3 -3DH0 - ? -
73 HHSearch 45.5014%-116 - C3 -1O54 - ? -
70 HHSearch 42.4118% -94 - C3 -2PWY - TRMI_THET2 -
72 HHSearch 42.3320%-114 - C3 -1SQG - RSMB_ECOLI -
63 HHSearch 40.4221% -99 - C3 -4FZV - NSUN4_HUMAN -
75 HHSearch 39.589%-123 - C3 -1XXL - YCGJ_BACSU -
68 HHSearch 38.7126% -93 - C3 -2YXL - ? -
10 PsiBlast_PDB 38.0025%-119 - C3 -4POO - ? -
45 Fugue 37.5819% -73 - C3 -3EEY - ? -
9 PsiBlast_PDB 37.2925%-117 - C- -4PON - ? -
57 HHSearch 37.0713%-107 - C- -1VL5 - ? -