@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15910: (2016-06-25 )
MLNDKTAIVTGASRGIGRSIALDLAKSGANVVVNYSGNEAKANEVVDEIKSMGRKAIAVKADVSNPEDVQNMIKETLSVFSTIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMKQRSGRIINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTDMTDKLAKDVQDEMLKQIPLARFGEPSDVSSVVTFLASEGARYMTGQTLHIDGGMVM

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_A_8(4I08)
FABG_VIBCH
[Raw transfer]




NAP_B_5(4JRO)
?
[Raw transfer]




NDP_A_3(3SJ7)
?
[Raw transfer]




NAP_A_8(3RSH)
FABG_VIBCH
[Raw transfer]




NDP_B_16(4I08)
FABG_VIBCH
[Raw transfer]




NAP_D_7(4JRO)
?
[Raw transfer]




NAP_B_6(4DMM)
?
[Raw transfer]




NDP_B_6(3SJ7)
?
[Raw transfer]




NAP_D_8(4DMM)
?
[Raw transfer]




NAP_E_5(1EDO)
FABG1_BRANA
[Raw transfer]




NAP_B_19(3RSH)
FABG_VIBCH
[Raw transfer]




NAP_D_16(1Q7B)
FABG_ECOLI
[Raw transfer]




NAP_C_15(1Q7B)
FABG_ECOLI
[Raw transfer]




NAP_B_14(1Q7B)
FABG_ECOLI
[Raw transfer]




NAP_C_7(4DMM)
?
[Raw transfer]




NAP_C_6(4JRO)
?
[Raw transfer]




NAP_A_13(1Q7B)
FABG_ECOLI
[Raw transfer]




NDP_B_6(4WK6)
?
[Raw transfer]




NDP_D_8(4WK6)
?
[Raw transfer]




NDP_C_7(4WK6)
?
[Raw transfer]




NAP_A_5(3TZC)
?
[Raw transfer]




EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




NDP_A_5(4WK6)
?
[Raw transfer]




1PE_B_5(2PNF)
FABG_AQUAE
[Raw transfer]




GOL_A_3(3GED)
?
[Raw transfer]




NAP_E_5(1Q7C)
FABG_ECOLI
[Raw transfer]




1PE_A_6(2PNF)
FABG_AQUAE
[Raw transfer]




NAP_G_7(1Q7C)
FABG_ECOLI
[Raw transfer]




PEG_A_6(3OSU)
FABG_STAAM
[Raw transfer]




PEG_A_3(3OSU)
FABG_STAAM
[Raw transfer]




EDO_A_7(4I08)
FABG_VIBCH
[Raw transfer]




PEG_B_17(3OSU)
FABG_STAAM
[Raw transfer]




PGE_B_24(3RRO)
FABG_VIBCH
[Raw transfer]




PGE_A_8(3RRO)
FABG_VIBCH
[Raw transfer]




9 PsiBlast_PDB 78.4658%-105 - C1 -4DML - ? -
1 PsiBlast_PDB 77.9073% -96 - C1 -2UVD - ? -
66 PsiBlast_CBE 76.2149%-124 - C1 -4BO6 - FABG_PSEAE -
4 PsiBlast_PDB 75.4861% -92 - C1 -4JRO - ? -
23 PsiBlast_CBE 74.4261% -90 - C1 -4JRO 11.6 ?
75 PsiBlast_CBE 74.3049%-123 - C1 -4BO3 - FABG_PSEAE -
25 PsiBlast_CBE 74.0758%-100 - C1 -4DMM 11.1 ?
26 PsiBlast_CBE 73.3358%-103 - C1 -4DMM 11.6 ?
21 PsiBlast_CBE 73.1164% -85 - C1 -3SJ7 11.6 ?
99 PsiBlast_CBE 73.0949%-114 - C1 -4BNW - FABG_PSEAE -
91 PsiBlast_CBE 73.0649%-117 - C1 -4BNZ - FABG_PSEAE -
5 PsiBlast_PDB 72.9758%-103 - C1 -4RZH - FABG1_SYNY3 -
90 PsiBlast_CBE 72.8449%-120 - C1 -4BNZ - FABG_PSEAE -
78 PsiBlast_CBE 72.6549%-115 - C1 -4BO2 - FABG_PSEAE -
58 PsiBlast_CBE 72.5749%-123 - C1 -4BO8 - FABG_PSEAE -
27 PsiBlast_CBE 72.2558%-101 - C1 -4DMM 11.7 ?
83 PsiBlast_CBE 72.2449%-117 - C1 -4BO1 - FABG_PSEAE -
63 PsiBlast_CBE 72.2049%-119 - C1 -4BO7 - FABG_PSEAE -
76 PsiBlast_CBE 72.0449%-127 - C1 -4BO3 - FABG_PSEAE -
84 PsiBlast_CBE 72.0249%-115 - C1 -4BO0 - FABG_PSEAE -
2 PsiBlast_PDB 71.5964% -81 - C1 -3SJ7 9.5 ?
22 PsiBlast_CBE 71.1361% -86 - C1 -4JRO 9.4 ?
12 PsiBlast_PDB 70.4353%-105 - C1 -4WK6 4.0 ?
30 PsiBlast_CBE 70.0853%-106 - C1 -4WK6 5.4 ?
29 PsiBlast_CBE 69.9453%-104 - C1 -4WK6 5.0 ?
3 PsiBlast_PDB 69.7962% -80 - C1 -3OSU 2.4 FABG_STAAM
7 PsiBlast_PDB 68.9954% -94 - C1 -1EDO 12.3 FABG1_BRANA
35 PsiBlast_CBE 68.4953% -92 - C1 -3RRO 2.6 FABG_VIBCH
47 PsiBlast_CBE 68.4850% -95 - C1 -1Q7B 7.7 FABG_ECOLI
33 PsiBlast_CBE 68.2353% -92 - C1 -4I08 10.5 FABG_VIBCH
28 PsiBlast_CBE 68.1053%-108 - C1 -4WK6 5.6 ?
15 PsiBlast_PDB 68.0453% -90 - C1 -3RRO 2.0 FABG_VIBCH
48 PsiBlast_CBE 67.9250% -95 - C1 -1Q7B 8.6 FABG_ECOLI
14 PsiBlast_PDB 67.5053% -91 - C1 -3RSH 11.9 FABG_VIBCH
24 PsiBlast_CBE 67.4661% -87 - C1 -4JRO 10.0 ?
34 PsiBlast_CBE 66.9453% -93 - C1 -3RSH 10.7 FABG_VIBCH
16 PsiBlast_PDB 66.3853% -95 - C1 -4I08 11.0 FABG_VIBCH
17 PsiBlast_PDB 66.0753%-110 - C1 -3TZC 4.9 ?
49 PsiBlast_CBE 66.0150% -93 - C1 -1Q7B 9.4 FABG_ECOLI
52 PsiBlast_CBE 65.9450% -92 - C1 -1Q7C 4.9 FABG_ECOLI
53 PsiBlast_CBE 64.6750% -97 - C1 -2PNF 3.0 FABG_AQUAE
50 PsiBlast_CBE 64.5250% -90 - C1 -1Q7B 8.5 FABG_ECOLI
51 PsiBlast_CBE 63.6950% -89 - C1 -1Q7C 4.4 FABG_ECOLI
54 PsiBlast_CBE 63.6250% -93 - C1 -2PNF 3.3 FABG_AQUAE