@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15950: (2016-06-25 )
MSFFKKLKEKITKQTDSVSEKFKDGLEKTRNSFQNKVNDLVSRYRKVDEDFFEELEEVLISADVGFTTVMELIDELKKEVKRRNIQDPKEVQSVISEKLVEIYNSGDEQISELNIQDGRLNVILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDTFRAGAIEQLEVWGERTGVPVIKQTAGSDPAAVIYDAVHAAKARNADVLICDTAGRLQNKVNLMKELEKVKRVIEREVPEAPHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELHIPVKLVGLGEKVDDLQEFDPESYVYGLFSDLVEKADD

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_6(2J7P)
FTSY_THEAQ
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GNP_B_20(2J7P)
SRP54_THEAQ
[Raw transfer]




GNP_A_12(2J7P)
SRP54_THEAQ
[Raw transfer]




GCP_D_17(1OKK)
FTSY_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
FTSY_ECOLI
[Raw transfer]




GDP_A_6(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GCP_B_6(1RJ9)
SRP54_THEAQ
[Raw transfer]




GNP_K_11(2Q9C)
FTSY_THEAQ
[Raw transfer]




GDP_C_14(4C7O)
FTSY_ECOLI
[Raw transfer]




GCP_A_3(1OKK)
FTSY_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
SRP54_ECOLI
[Raw transfer]




GNP_B_2(1JPJ)
SRP54_THEAQ
[Raw transfer]




GNP_B_5(1JPN)
SRP54_THEAQ
[Raw transfer]




GNP_A_6(1JPN)
SRP54_THEAQ
[Raw transfer]




GDP_A_8(4C7O)
FTSY_ECOLI
[Raw transfer]




GNP_T_20(2Q9B)
FTSY_THEAQ
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




GOL_B_14(3DMD)
?
[Raw transfer]




GOL_C_16(3DMD)
?
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
SRP54_ECOLI
[Raw transfer]




CIT_B_4(1VMA)
?
[Raw transfer]




GDP_B_12(1O87)
SRP54_THEAQ
[Raw transfer]




GDP_B_2(2NG1)
SRP54_THEAQ
[Raw transfer]




GOL_A_15(3DMD)
?
[Raw transfer]




GDP_D_2(2IYL)
FTSY_THEAQ
[Raw transfer]




GNP_A_12(2J7P)
FTSY_THEAQ
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




GDP_C_2(3E70)
?
[Raw transfer]




GDP_A_7(1NG1)
SRP54_THEAQ
[Raw transfer]




FMT_A_5(1O87)
SRP54_THEAQ
[Raw transfer]




GCP_D_17(1OKK)
SRP54_THEAQ
[Raw transfer]




FMT_B_11(1O87)
SRP54_THEAQ
[Raw transfer]




EDO_B_13(3NG1)
SRP54_THEAQ
[Raw transfer]




OXY_A_3(1LS1)
SRP54_THEAQ
[Raw transfer]




OXY_A_3(1LS1)
SRP54_THEAQ
[Raw transfer]




EDO_A_3(2YHS)
FTSY_ECOLI
[Raw transfer]




GDP_D_18(4C7O)
SRP54_ECOLI
[Raw transfer]




GDP_D_18(4C7O)
FTSY_ECOLI
[Raw transfer]




EDO_B_14(3NG1)
SRP54_THEAQ
[Raw transfer]




EDO_A_12(3NG1)
SRP54_THEAQ
[Raw transfer]




ACY_B_7(1JPN)
SRP54_THEAQ
[Raw transfer]




ACY_A_9(1JPN)
SRP54_THEAQ
[Raw transfer]




94 HHSearch 82.2754%-108 - C8 -1VMA - ? -
9 PsiBlast_PDB 81.7953%-110 - C8 -1VMA - ? -
23 PsiBlast_CBE 81.6353%-113 - C8 -1VMA 3.8 ?
103 HHSearch 81.2145%-120 - C8 -1ZU4 - FTSY_MYCMS -
3 PsiBlast_PDB 80.7850%-119 - C8 -2YHS - FTSY_ECOLI -
6 PsiBlast_PDB 80.7653%-119 - C8 -4C7O 7.0 FTSY_ECOLI
22 PsiBlast_CBE 80.4853%-121 - C8 -4C7O 3.3 FTSY_ECOLI
4 PsiBlast_PDB 80.4153%-129 - C8 -1FTS - FTSY_ECOLI -
89 HHSearch 80.2740%-126 - C8 -3B9Q - CFTSY_ARATH -
88 HHSearch 80.2150%-120 - C8 -2YHS 2.8 FTSY_ECOLI
2 PsiBlast_PDB 80.0750%-116 - C8 -2QY9 - FTSY_ECOLI -
12 PsiBlast_PDB 80.0540%-121 - C8 -3B9Q - CFTSY_ARATH -
7 PsiBlast_PDB 79.9745%-118 - C8 -1ZU4 - FTSY_MYCMS -
1 PsiBlast_PDB 79.7150%-120 - C8 -2XXA - FTSY_ECOLI -
5 PsiBlast_PDB 79.6553%-129 - C8 -3ZN8 - FTSY_ECOLI -
8 PsiBlast_PDB 79.6445%-116 - C8 -1ZU5 - FTSY_MYCMS -
21 PsiBlast_CBE 79.6250%-120 - C8 -2XXA - FTSY_ECOLI -
87 HHSearch 77.4340%-122 - C8 -2OG2 - CFTSY_ARATH -
11 PsiBlast_PDB 76.6440%-118 - C8 -2OG2 - CFTSY_ARATH -
10 PsiBlast_PDB 75.7244%-125 - C8 -4AK9 - ? -
101 HHSearch 73.8447%-118 - C8 -1RJ9 2.5 FTSY_THEAQ
30 PsiBlast_CBE 70.7747%-110 - C8 -1RJ9 2.5 FTSY_THEAQ
20 PsiBlast_PDB 70.7748%-121 - C8 -2IYL 7.2 FTSY_THEAQ
18 PsiBlast_PDB 70.1948%-112 - C8 -2J7P 2.7 FTSY_THEAQ
96 HHSearch 69.8243%-124 - C8 -3E70 7.1 ?
16 PsiBlast_PDB 69.6948%-115 - C8 -1OKK 9.2 FTSY_THEAQ
15 PsiBlast_PDB 69.3048%-110 - C8 -2Q9C 6.4 FTSY_THEAQ
70 PsiBlast_CBE 69.1033%-117 - C8 -4C7O 4.0 SRP54_ECOLI
98 HHSearch 69.0432%-115 - C8 -3DM5 Error SRP54_PYRFU
14 PsiBlast_PDB 68.8548%-110 - C8 -2Q9B 5.9 FTSY_THEAQ
34 PsiBlast_CBE 67.8340%-122 - C8 -3DMD 2.3 ?
32 PsiBlast_CBE 67.6240%-126 - C8 -3DMD 2.3 ?
67 PsiBlast_CBE 67.6032%-111 - C8 -3DM5 Error SRP54_PYRFU
31 PsiBlast_CBE 67.5040%-121 - C8 -3E70 7.1 ?
66 PsiBlast_CBE 67.0932%-113 - C8 -3DM5 7.0 SRP54_PYRFU
33 PsiBlast_CBE 66.8640%-123 - C8 -3DMD 3.4 ?
71 PsiBlast_CBE 66.5733%-116 - C8 -4C7O 3.0 SRP54_ECOLI
90 HHSearch 66.5432%-106 - C8 -4C7O 3.0 SRP54_ECOLI
47 PsiBlast_CBE 63.6935%-104 - C8 -2J7P 9.3 SRP54_THEAQ
53 PsiBlast_CBE 63.1235%-105 - C8 -1NG1 7.6 SRP54_THEAQ
45 PsiBlast_CBE 63.0135%-107 - C8 -3NG1 3.7 SRP54_THEAQ
48 PsiBlast_CBE 62.8735%-100 - C8 -2J7P 9.3 SRP54_THEAQ
46 PsiBlast_CBE 62.8135%-107 - C8 -3NG1 3.7 SRP54_THEAQ
52 PsiBlast_CBE 62.7935%-102 - C8 -1OKK 2.6 SRP54_THEAQ
57 PsiBlast_CBE 62.6035%-101 - C8 -1JPJ 7.6 SRP54_THEAQ
99 HHSearch 62.4536%-116 * C8 *1LS1 3.2 SRP54_THEAQ
56 PsiBlast_CBE 61.8435%-106 - C8 -1JPN 7.5 SRP54_THEAQ
65 PsiBlast_CBE 61.7935%-104 - C8 -1O87 7.1 SRP54_THEAQ
64 PsiBlast_CBE 61.7835% -98 - C8 -1O87 7.1 SRP54_THEAQ
55 PsiBlast_CBE 61.6635%-105 - C8 -1JPN 6.5 SRP54_THEAQ
41 PsiBlast_CBE 61.4135% -99 - C8 -2NG1 6.3 SRP54_THEAQ
42 PsiBlast_CBE 61.3535%-110 - C8 -1LS1 3.2 SRP54_THEAQ
54 PsiBlast_CBE 59.4635% -92 - C8 -1RJ9 9.4 SRP54_THEAQ