@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16530: (2016-06-26 )
MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEGMKVVKRTTKLANELGVKVLTLYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQVRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYGGRTEIVSAAKSLAEKVKEGSLNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKEDHFLQALGEFQQRGRRFGGI

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

B08_B_6(2E99)
UPPS_ECOLI
[Raw transfer]




B08_A_3(2E99)
UPPS_ECOLI
[Raw transfer]




H78_A_3(3WYJ)
UPPS_ECOLI
[Raw transfer]




FPS_C_3(1X08)
UPPS_ECOLI
[Raw transfer]




GPP_D_19(2VG3)
DPDS_MYCTU
[Raw transfer]




B75_A_3(2E9C)
UPPS_ECOLI
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




B75_B_5(2E9C)
UPPS_ECOLI
[Raw transfer]




B29_A_3(2E98)
UPPS_ECOLI
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




FPP_C_3(1V7U)
UPPS_ECOLI
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




FPS_A_4(1X06)
UPPS_ECOLI
[Raw transfer]




FPS_A_3(4U82)
ISPT_STAAN
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




GPP_B_9(2VG3)
DPDS_MYCTU
[Raw transfer]




IPE_A_3(1X09)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X07)
UPPS_ECOLI
[Raw transfer]




DPO_C_20(2VG2)
DPDS_MYCTU
[Raw transfer]




2BJ_A_5(3SGV)
UPPS_ECOLI
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




B76_A_3(2E9D)
UPPS_ECOLI
[Raw transfer]




40B_B_4(4ONC)
DPDS_MYCTU
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




DPO_A_5(2VG2)
DPDS_MYCTU
[Raw transfer]




DPO_C_3(2DTN)
ISPT_HELPY
[Raw transfer]




GPP_C_15(2VG3)
DPDS_MYCTU
[Raw transfer]




B28_B_5(2E9A)
UPPS_ECOLI
[Raw transfer]




TH9_B_3(3TH8)
UPPS_ECOLI
[Raw transfer]




DST_A_4(5HC7)
?
[Raw transfer]




GOL_B_19(2VG2)
DPDS_MYCTU
[Raw transfer]




0FW_A_4(3SGX)
UPPS_ECOLI
[Raw transfer]




40B_A_3(4ONC)
DPDS_MYCTU
[Raw transfer]




B08_A_5(2E99)
UPPS_ECOLI
[Raw transfer]




FPP_B_11(2VG1)
ZFPP_MYCTU
[Raw transfer]




ISY_A_6(5HC8)
?
[Raw transfer]




B29_A_5(2E98)
UPPS_ECOLI
[Raw transfer]




ISY_A_6(5HC8)
?
[Raw transfer]




SAX_B_3(3SH0)
UPPS_ECOLI
[Raw transfer]




P09_B_3(3SGT)
UPPS_ECOL6
[Raw transfer]




B28_A_4(2E9A)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




FFT_A_4(3UGS)
ISPT_CAMJE
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




B08_B_7(2E99)
UPPS_ECOLI
[Raw transfer]




IPE_B_15(2VG2)
DPDS_MYCTU
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




0YW_B_4(4H2O)
UPPS_ECOLI
[Raw transfer]




IPE_A_6(2VG2)
DPDS_MYCTU
[Raw transfer]




53Q_A_3(5CQJ)
UPPS_ECOLI
[Raw transfer]




0YZ_A_4(4H3C)
UPPS_ECOLI
[Raw transfer]




2ZW_A_3(4Q9O)
ISPT_STRR6
[Raw transfer]




2ZW_B_5(4Q9O)
ISPT_STRR6
[Raw transfer]




B29_B_8(2E98)
UPPS_ECOLI
[Raw transfer]




OXN_B_11(1UEH)
UPPS_ECOLI
[Raw transfer]




2BJ_A_7(3SGV)
UPPS_ECOLI
[Raw transfer]




EGC_A_3(1JP3)
UPPS_ECOLI
[Raw transfer]




2 PsiBlast_PDB 85.1855%-104 - C4 -4H8E 9.9 ISPT_STAAN
3 PsiBlast_PDB 84.9555%-105 - C4 -4U82 9.9 ISPT_STAAN
126 HHSearch 84.7954%-104 - C4 -4H8E 9.9 ISPT_STAAN
57 PsiBlast_CBE 83.9744%-122 - C4 -2VG3 7.9 DPDS_MYCTU
56 PsiBlast_CBE 83.1944%-121 - C4 -2VG3 7.1 DPDS_MYCTU
59 PsiBlast_CBE 83.1344%-123 - C4 -2VG2 2.6 DPDS_MYCTU
54 PsiBlast_CBE 83.0244%-121 - C4 -4ONC 7.3 DPDS_MYCTU
61 PsiBlast_CBE 82.6744%-120 - C4 -2VG2 4.2 DPDS_MYCTU
60 PsiBlast_CBE 82.4444%-119 - C4 -2VG2 3.8 DPDS_MYCTU
62 PsiBlast_CBE 82.4144%-116 - C4 -2VG2 3.1 DPDS_MYCTU
58 PsiBlast_CBE 82.4144%-118 - C4 -2VG3 7.8 DPDS_MYCTU
53 PsiBlast_CBE 82.4144%-122 - C4 -4ONC 4.4 DPDS_MYCTU
55 PsiBlast_CBE 82.2144%-124 - C4 -2VG3 7.3 DPDS_MYCTU
46 PsiBlast_CBE 82.2049%-124 - C4 -1UEH 3.5 UPPS_ECOLI
9 PsiBlast_PDB 82.1049%-117 - C4 -1X06 9.5 UPPS_ECOLI
22 PsiBlast_CBE 81.6954% -99 - C4 -4Q9O 8.6 ISPT_STRR6
50 PsiBlast_CBE 81.5645%-111 - C4 -5HC8 3.1 ?
10 PsiBlast_PDB 81.5549%-123 - C4 -1X07 6.0 UPPS_ECOLI
8 PsiBlast_PDB 81.4249%-119 - C4 -1V7U 7.0 UPPS_ECOLI
130 HHSearch 81.3543%-106 - C4 -5HC8 3.1 ?
51 PsiBlast_CBE 81.3445%-111 - C4 -5HC7 2.5 ?
127 HHSearch 81.1154% -99 - C4 -4Q9M 8.4 ISPT_STRR6
49 PsiBlast_CBE 80.9949%-118 - C4 -1X08 8.0 UPPS_ECOLI
23 PsiBlast_CBE 80.9154%-103 - C4 -4Q9M 8.4 ISPT_STRR6
48 PsiBlast_CBE 80.6949%-118 - C4 -1X09 5.0 UPPS_ECOLI
5 PsiBlast_PDB 80.6454%-100 - C4 -4Q9M 8.4 ISPT_STRR6
6 PsiBlast_PDB 80.5954% -96 - C4 -4Q9O 8.6 ISPT_STRR6
18 PsiBlast_PDB 80.5249%-124 - C4 -3SGT 6.5 UPPS_ECOL6
37 PsiBlast_CBE 80.3249%-131 - C4 -3SH0 6.3 UPPS_ECOLI
35 PsiBlast_CBE 78.8449%-127 - C4 -3WYJ 9.1 UPPS_ECOLI
39 PsiBlast_CBE 77.8949%-123 - C4 -3SGV 5.0 UPPS_ECOLI
11 PsiBlast_PDB 77.7249%-113 - C4 -2E98 9.1 UPPS_ECOLI
12 PsiBlast_PDB 77.3649%-112 - C4 -2E99 7.2 UPPS_ECOLI
43 PsiBlast_CBE 77.3149%-128 - C4 -2E99 5.3 UPPS_ECOLI
42 PsiBlast_CBE 77.2449%-128 - C4 -2E9A 3.9 UPPS_ECOLI
44 PsiBlast_CBE 77.1349%-128 - C4 -2E98 4.2 UPPS_ECOLI
19 PsiBlast_PDB 76.6649%-131 - C4 -3SGV 7.0 UPPS_ECOLI
24 PsiBlast_CBE 76.2249%-130 - C4 -5CQJ 3.6 UPPS_ECOLI
20 PsiBlast_PDB 76.1249%-127 - C4 -3SGX 6.4 UPPS_ECOLI
13 PsiBlast_PDB 76.1249%-119 - C4 -2E9A 6.0 UPPS_ECOLI
125 HHSearch 75.4148%-121 * C4 *3SGV 7.0 UPPS_ECOLI
15 PsiBlast_PDB 75.2049%-121 - C4 -2E9D 5.1 UPPS_ECOLI
26 PsiBlast_CBE 74.4049%-126 - C4 -4H3C 5.2 UPPS_ECOLI
41 PsiBlast_CBE 73.5349%-123 - C4 -2E9C 7.3 UPPS_ECOLI
36 PsiBlast_CBE 73.3149%-124 - C4 -3TH8 4.9 UPPS_ECOLI
66 PsiBlast_CBE 72.7134%-133 - C4 -2VG1 7.0 ZFPP_MYCTU
14 PsiBlast_PDB 72.6649%-125 - C4 -2E9C 6.6 UPPS_ECOLI
30 PsiBlast_CBE 69.1049%-119 - C4 -4H2O 4.1 UPPS_ECOLI
115 Fugue 67.2147%-102 - C4 -1JP3 1.9 UPPS_ECOLI
63 PsiBlast_CBE 67.1142%-107 - C4 -2DTN 4.7 ISPT_HELPY
131 HHSearch 66.2235%-122 - C4 -3UGS 5.3 ISPT_CAMJE
64 PsiBlast_CBE 64.9136%-120 - C4 -3UGS 5.3 ISPT_CAMJE
65 PsiBlast_CBE 64.1236%-119 - C4 -3UGS 6.0 ISPT_CAMJE