@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16770: (2016-06-26 )
MNFGNVSTAMITPFDNKGNVDFQKLSTLIDYLLKNGTDSLVVAGTTGESPTLSTEEKIALFEYTVKEVNGRVPVIAGTGSNNTKDSIKLTKKAEEAGVDAVMLVTPYYNKPSQEGMYQHFKAIAAETSLPVMLYNVPGRTVASLAPETTIRLAADIPNVVAIKEASGDLEAITKIIAETPEDFYVYSGDDALTLPILSVGGRGVVSVASHIAGTDMQQMIKNYTNGQTANAALIHQKLLPIMKELFKAPNPAPVKTALQLRGLDVGSVRLPLVPLTEDERLSLSSTISEL

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LYS_B_5(3PUE)
?
[Raw transfer]




GOL_B_11(3VFL)
?
[Raw transfer]




GOL_A_6(3VFL)
?
[Raw transfer]




LYS_B_6(3PUL)
?
[Raw transfer]




LYS_A_5(3PUO)
DAPA_PSEAE
[Raw transfer]




3VN_D_17(5F1U)
?
[Raw transfer]




3VN_A_5(5F1U)
?
[Raw transfer]




3VN_D_17(5F1U)
?
[Raw transfer]




3VN_B_13(5F1V)
?
[Raw transfer]




LYS_B_7(1YXD)
DAPA_ECOLI
[Raw transfer]




LYS_B_7(1YXD)
DAPA_ECOLI
[Raw transfer]




DLY_A_7(2ATS)
DAPA_ECOLI
[Raw transfer]




DLY_A_7(2ATS)
DAPA_ECOLI
[Raw transfer]




GOL_B_22(3FLU)
DAPA_NEIMB
[Raw transfer]




GOL_B_10(3G0S)
DAPA_SALTY
[Raw transfer]




GOL_B_9(3I7Q)
DAPA_ECOLI
[Raw transfer]




GOL_B_11(3I7S)
DAPA_ECOLI
[Raw transfer]




3VN_A_5(5F1U)
?
[Raw transfer]




LYS_A_4(4PFM)
?
[Raw transfer]




GOL_B_13(3I7R)
DAPA_ECOLI
[Raw transfer]




GOL_B_22(3FLU)
DAPA_NEIMB
[Raw transfer]




GOL_B_22(3FLU)
DAPA_NEIMB
[Raw transfer]




GOL_B_8(3PUD)
?
[Raw transfer]




GOL_B_9(3I7Q)
DAPA_ECOLI
[Raw transfer]




GOL_A_6(3IRD)
?
[Raw transfer]




GOL_B_13(3I7R)
DAPA_ECOLI
[Raw transfer]




GOL_B_10(3G0S)
DAPA_SALTY
[Raw transfer]




GOL_B_11(3I7S)
DAPA_ECOLI
[Raw transfer]




LYZ_B_4(3TCE)
?
[Raw transfer]




LYZ_A_3(3TCE)
?
[Raw transfer]




LYS_B_6(3PUO)
DAPA_PSEAE
[Raw transfer]




EDO_A_6(3SI9)
DAPA_BARHE
[Raw transfer]




LYS_B_7(4PFM)
?
[Raw transfer]




LYS_B_7(4PFM)
?
[Raw transfer]




LYS_A_5(3PUO)
DAPA_PSEAE
[Raw transfer]




PGO_A_3(3NOE)
DAPA_PSEAE
[Raw transfer]




PGO_A_3(3PS7)
DAPA_PSEAE
[Raw transfer]




1 PsiBlast_PDB 91.9860%-108 - C4 -1XKY - ? -
21 PsiBlast_CBE 91.6960%-102 - C4 -1XKY - ? -
22 PsiBlast_CBE 90.7660%-101 - C4 -1XKY - ? -
104 HHSearch 90.7561%-106 - C4 -1XKY - ? -
23 PsiBlast_CBE 89.5760%-106 - C4 -1XKY - ? -
2 PsiBlast_PDB 87.9760%-101 - C- -1XL9 - ? -
31 PsiBlast_CBE 80.1046%-104 - C4 -3VFL Error ?
5 PsiBlast_PDB 78.3046%-102 - C4 -3VFL Error ?
55 PsiBlast_CBE 77.3442%-100 - C4 -2EHH - DAPA_AQUAE -
132 Fugue 77.2145% -95 - C4 -1DHP - DAPA_ECOLI -
57 PsiBlast_CBE 77.1942%-100 - C4 -2EHH - DAPA_AQUAE -
120 HHSearch 76.8547% -87 - C4 -3FLU 2.1 DAPA_NEIMB
119 HHSearch 76.6541% -97 - C4 -2EHH - DAPA_AQUAE -
106 HHSearch 76.5744% -91 * C4 *3QZE - DAPA_PSEAE -
58 PsiBlast_CBE 76.4742% -98 - C4 -2EHH - DAPA_AQUAE -
56 PsiBlast_CBE 76.3542% -98 - C4 -2EHH - DAPA_AQUAE -
8 PsiBlast_PDB 76.3146% -94 - C4 -3PB0 - DAPA_THEMA -
36 PsiBlast_CBE 76.3046% -97 - C4 -3PB0 - DAPA_THEMA -
28 PsiBlast_CBE 76.0546% -90 - C4 -3PB2 - DAPA_THEMA -
18 PsiBlast_PDB 75.9845% -96 - C4 -1S5T - DAPA_ECOLI -
39 PsiBlast_CBE 75.1945% -93 - C4 -1YXD 3.2 DAPA_ECOLI
14 PsiBlast_PDB 75.1545% -94 - C4 -3I7R 2.1 DAPA_ECOLI
44 PsiBlast_CBE 75.0945% -96 - C4 -3I7Q 3.2 DAPA_ECOLI
13 PsiBlast_PDB 75.0745% -95 - C4 -3I7Q 2.1 DAPA_ECOLI
3 PsiBlast_PDB 74.8249% -90 - C4 -3FLU 2.1 DAPA_NEIMB
35 PsiBlast_CBE 74.7347% -93 - C4 -3G0S 2.4 DAPA_SALTY
38 PsiBlast_CBE 74.6345% -92 - C4 -2ATS 3.6 DAPA_ECOLI
15 PsiBlast_PDB 74.5345% -95 - C4 -3I7S 2.1 DAPA_ECOLI
43 PsiBlast_CBE 74.4845% -94 - C4 -3I7R 3.2 DAPA_ECOLI
42 PsiBlast_CBE 73.8945% -91 - C4 -3I7S 2.3 DAPA_ECOLI
54 PsiBlast_CBE 73.8447% -87 - C4 -3NOE 3.0 DAPA_PSEAE
12 PsiBlast_PDB 73.7545% -91 - C4 -2ATS 2.9 DAPA_ECOLI
49 PsiBlast_CBE 73.7347% -87 - C4 -3PUO 2.7 DAPA_PSEAE
50 PsiBlast_CBE 73.6847% -92 - C4 -3PUO 3.4 DAPA_PSEAE
7 PsiBlast_PDB 73.6847% -90 - C4 -3G0S 2.1 DAPA_SALTY
26 PsiBlast_CBE 73.5849% -91 - C4 -3FLU 2.2 DAPA_NEIMB
11 PsiBlast_PDB 73.3745% -92 - C4 -1YXD 3.1 DAPA_ECOLI
107 HHSearch 73.3640% -99 - C4 -4PFM 3.1 ?
59 PsiBlast_CBE 72.7544% -87 - C4 -3IRD 2.4 ?
52 PsiBlast_CBE 72.7547% -86 - C4 -3PS7 3.0 DAPA_PSEAE
96 PsiBlast_CBE 71.4342% -94 - C4 -4PFM 3.1 ?
95 PsiBlast_CBE 71.1442% -93 - C4 -4PFM 2.7 ?
112 HHSearch 70.6837% -83 - C4 -3SI9 2.2 DAPA_BARHE
79 PsiBlast_CBE 69.6242% -90 - C4 -3PUD 2.8 ?
101 PsiBlast_CBE 69.1543% -92 - C4 -5F1V 3.0 ?
69 PsiBlast_CBE 68.8242% -84 - C4 -3TCE 3.2 ?
77 PsiBlast_CBE 68.5142% -88 - C4 -3PUE Error ?
100 PsiBlast_CBE 68.2943% -88 - C4 -5F1U 2.6 ?
75 PsiBlast_CBE 68.1042% -86 - C4 -3PUL Error ?
98 PsiBlast_CBE 67.7143% -88 - C4 -5F1U 4.1 ?
99 PsiBlast_CBE 67.5843% -89 - C4 -5F1U 4.2 ?
68 PsiBlast_CBE 67.1442% -85 - C4 -3TCE 1.9 ?
97 PsiBlast_CBE 66.2843% -88 - C4 -5F1U 4.6 ?