@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu18630: (2016-06-30 )
MKKIMSAFVGMVLLTIFCFSPQASAAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CE6_A_7(4FER)
YOAJ_BACSU
[Raw transfer]




CTT_A_5(4FG2)
YOAJ_BACSU
[Raw transfer]




0TS_B_3(4FG4)
YOAJ_BACSU
[Raw transfer]




FMT_A_4(3D30)
YOAJ_BACSU
[Raw transfer]




FMT_A_4(3D30)
YOAJ_BACSU
[Raw transfer]




SUGAR_B_6(4FFT)
YOAJ_BACSU
[Raw transfer]

-

CTT_A_5(4FG2)
YOAJ_BACSU
[Raw transfer]




SUGAR_B_6(4FFT)
YOAJ_BACSU
[Raw transfer]

-

CE6_A_7(4FER)
YOAJ_BACSU
[Raw transfer]




0TS_B_3(4FG4)
YOAJ_BACSU
[Raw transfer]




51 Fugue 82.3599% -67 - C3 -3D30 3.4 YOAJ_BACSU
1 PsiBlast_PDB 81.96100% -67 - C3 -3D30 - YOAJ_BACSU -
24 PsiBlast_CBE 81.89100% -65 - C3 -4FER 4.7 YOAJ_BACSU
27 HHSearch 81.70100% -64 - C3 -3D30 3.4 YOAJ_BACSU
22 PsiBlast_CBE 81.32100% -63 - C3 -4FG2 4.2 YOAJ_BACSU
3 PsiBlast_PDB 81.14100% -65 - C3 -4FFT 7.0 YOAJ_BACSU
2 PsiBlast_PDB 81.03100% -62 - C3 -4FER 4.9 YOAJ_BACSU
6 PsiBlast_PDB 80.9896% -71 - C3 -2BH0 - YOAJ_BACSU -
23 PsiBlast_CBE 80.95100% -64 - C3 -4FFT 7.2 YOAJ_BACSU
4 PsiBlast_PDB 80.94100% -65 - C3 -4FG2 4.2 YOAJ_BACSU
21 PsiBlast_CBE 80.49100% -66 - C3 -4FG4 4.8 YOAJ_BACSU
5 PsiBlast_PDB 80.48100% -64 - C3 -4FG4 4.4 YOAJ_BACSU
25 PsiBlast_CBE 54.0033% -70 - C3 -4JCW - ? -
9 PsiBlast_PDB 53.4433% -76 - C3 -4JS7 - ? -
10 PsiBlast_PDB 53.1733% -70 - C3 -4L48 - ? -
26 PsiBlast_CBE 53.1633% -72 - C3 -4L48 - ? -
7 PsiBlast_PDB 52.3933% -72 - C3 -4JCW - ? -
28 HHSearch 48.6631% 37 * C3 *4JCW - ? -
8 PsiBlast_PDB 48.3733% -70 - C- -4JJO - ? -
53 Fugue 41.6824% 47 - C3 -1N10 - MPAP1_PHLPR -