@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22340: (2016-07-04 )
MLNLKQIEFCLDKIGDMFPHAECELVHSNPFELVVAVALSAQCTDALVNRVTKTLFQKYKRPEDYLAVPLEELQQDIKSIGLYRNKAKNIQKLSKMIIEDYGGEVPRDRDELVKLPGVGRKTANVVVSVAFGVPAIAVDTHVERVSKRLGICRWKDSVLEVEKTLMRKVPKEDWSVTHHRLIFFGRYHCKAQSPRCAECPLLSLCREGQKRDKKGLVKR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_B_1(1P59)
?
[Raw transfer]

-

NACID_B_1(1ORP)
?
[Raw transfer]

-

NACID_B_1(1ORN)
?
[Raw transfer]

-

NACID_B_1(1ORN)
?
[Raw transfer]

-

1 PsiBlast_PDB 97.0578%-144 - C1 -1ORN 5.7 ?
32 HHSearch 96.7478%-139 - C1 -1ORN 5.7 ?
2 PsiBlast_PDB 96.4578%-142 - C1 -1ORP 5.3 ?
3 PsiBlast_PDB 96.1077%-140 - C1 -1P59 6.7 ?
31 HHSearch 82.0945%-138 - C1 -2ABK - END3_ECOLI -
4 PsiBlast_PDB 80.5745%-139 - C1 -2ABK - END3_ECOLI -
35 HHSearch 56.2427% -10 - C1 -4UOB - ? -
24 Fugue 56.1822% -73 - C1 -1RRQ - MUTY_GEOSE -
5 PsiBlast_PDB 55.9531%-102 - C1 -1KEA - GTMR_METTF -
12 PsiBlast_PDB 55.3629% -18 - C1 -4UOB - ? -
19 PsiBlast_PDB 54.1724%-100 - C1 -1WEI - MUTY_ECOLI -
17 PsiBlast_PDB 53.2624% -85 - C1 -1KG5 - MUTY_ECOLI -
18 PsiBlast_PDB 51.6624% -73 - C1 -1WEF - MUTY_ECOLI -
37 HHSearch 49.5724% -46 - C1 -4UNF - ? -
34 HHSearch 48.5428% -30 - C1 -1KEA - GTMR_METTF -
38 HHSearch 48.1224% -35 - C1 -3FSP - MUTY_GEOSE -
20 PsiBlast_PDB 47.6724% -76 - C1 -1MUY - MUTY_ECOLI -
36 HHSearch 43.4124% -16 - C1 -3N5N - MUTYH_HUMAN -
33 HHSearch 41.1623% -10 - C1 -1KG2 - MUTY_ECOLI -
47 HHSearch 40.1417%-103 - C1 -4OFA - -