@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu28310: (2016-07-14 )
MGTNVQVDSASAECTQTMSGALMLIESLKKEKVEMIFGYPGGAVLPIYDKLYNSGLVHILPRHEQGAIHAAEGYARVSGKPGVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSVIGSDAFQEADILGITMPVTKHSYQVRQPEDLPRIIKEAFHIATTGRPGPVLIDIPKDVATIEGEFSYDHEMNLPGYQPTTEPNYLQIRKLVEAVSSAKKPVILAGAGVLHGKASEELKNYAEQQQIPVAHTLLGLGGFPADHPLFLGMAGMHGTYTANMALHECDLLISIGARFDDRVTGNLKHFARNAKIAHIDIDPAEIGKIMKTQIPVVGDSKIVLQELIKQDGKQSDSSEWKKQLAEWKEEYPLWYVDNEEEGFKPQKLIEYIHQFTKGEAIVATDVGQHQMWSAQFYPFQKADKWVTSGGLGTMGFGLPAAIGAQLAEKDATVVAVVGDGGFQMTLQELDVIRELNLPVKVVILNNACLGMVRQWQEIFYEERYSESKFASQPDFVKLSEAYGIKGIRISSEAEAKEKLEEALTSREPVVIDVRVASEEKVFPMVAPGKGLHEMVGVKP

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_4(5FEM)
?
[Raw transfer]




FAD_B_8(5FEM)
?
[Raw transfer]




FAD_A_9(1T9C)
ILVB_YEAST
[Raw transfer]




1CS_A_7(1T9B)
ILVB_YEAST
[Raw transfer]




FAD_A_10(1N0H)
ILVB_YEAST
[Raw transfer]




60G_B_10(5FEM)
?
[Raw transfer]




FAD_B_11(1T9C)
ILVB_YEAST
[Raw transfer]




FAD_B_14(1T9A)
ILVB_YEAST
[Raw transfer]




FAD_A_9(1T9B)
ILVB_YEAST
[Raw transfer]




1CS_B_11(1T9B)
ILVB_YEAST
[Raw transfer]




FAD_B_14(1N0H)
ILVB_YEAST
[Raw transfer]




FAD_A_4(5FEM)
?
[Raw transfer]




FAD_A_10(1T9A)
ILVB_YEAST
[Raw transfer]




FAD_B_12(1T9B)
ILVB_YEAST
[Raw transfer]




1TB_B_11(1T9A)
ILVB_YEAST
[Raw transfer]




1TB_A_7(1T9A)
ILVB_YEAST
[Raw transfer]




60G_A_5(5FEM)
?
[Raw transfer]




FAD_A_11(1JSC)
ILVB_YEAST
[Raw transfer]




1SM_A_7(1T9C)
ILVB_YEAST
[Raw transfer]




1SM_B_10(1T9C)
ILVB_YEAST
[Raw transfer]




CIE_B_11(1N0H)
ILVB_YEAST
[Raw transfer]




CIE_A_7(1N0H)
ILVB_YEAST
[Raw transfer]




AYD_A_9(1N0H)
ILVB_YEAST
[Raw transfer]




TPP_B_6(5AHK)
?
[Raw transfer]




TPP_A_3(5AHK)
?
[Raw transfer]




TDP_A_3(3EY9)
POXB_ECOLI
[Raw transfer]




23 PsiBlast_CBE 90.8746% -13 - C5 -1T9D - ILVB_YEAST -
24 PsiBlast_CBE 89.5546% -7 - C5 -1T9D - ILVB_YEAST -
30 HHSearch 89.0447% 2 - C5 -5FEM 9.8 ?
3 PsiBlast_PDB 88.9746% -3 - C5 -1T9B 9.8 ILVB_YEAST
26 PsiBlast_CBE 88.8746% 1 - C5 -1T9B 12.3 ILVB_YEAST
6 PsiBlast_PDB 88.7446% 1 - C5 -5FEM 11.8 ?
25 PsiBlast_CBE 88.7146% 1 - C5 -1T9C 12.0 ILVB_YEAST
2 PsiBlast_PDB 88.5946% 1 - C5 -1T9A 11.4 ILVB_YEAST
27 PsiBlast_CBE 88.5046% 1 - C5 -1T9A 11.9 ILVB_YEAST
21 PsiBlast_CBE 88.4746% 3 - C5 -5FEM 12.3 ?
4 PsiBlast_PDB 88.3846% 2 - C5 -1T9C 11.1 ILVB_YEAST
5 PsiBlast_PDB 88.1446% 1 - C5 -1T9D - ILVB_YEAST -
22 PsiBlast_CBE 87.9546% 2 - C5 -1T9D - ILVB_YEAST -
28 PsiBlast_CBE 87.9446% 0 - C5 -1N0H 11.2 ILVB_YEAST
1 PsiBlast_PDB 87.2746% 2 - C5 -1N0H 10.8 ILVB_YEAST
32 HHSearch 84.7635% -21 * C5 *2PAN - GCL_ECOLI -
7 PsiBlast_PDB 83.9246% 5 - C5 -1JSC 12.0 ILVB_YEAST
8 PsiBlast_PDB 82.2935% -19 - C5 -2PAN - GCL_ECOLI -
13 PsiBlast_PDB 78.4026% -41 - C5 -4RJK - ? -
14 PsiBlast_PDB 78.0826% -43 - C5 -4RJI - ? -
38 HHSearch 75.1132% -6 - C5 -5AHK 7.9 ?
29 PsiBlast_CBE 71.5332% 4 - C5 -5AHK 8.1 ?