@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu30340: (2016-07-19 )
MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFVGIQNDITKQKEYEKLLEDSLTEITALSTPIVPIRNGISALPLVGNLTEERFNSIVCTLTNILSTSKDDYLIIDLSGLAQVNEQTADQIFKLSHLLKLTGTELIITGIKPELAMKMNKLDANFSSLKTYSNVKDAVKVLPIM

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_3(4WF0)
?
[Raw transfer]




RBF_D_8(4R38)
LVHK2_ERYLH
[Raw transfer]




RBF_C_7(4R38)
LVHK2_ERYLH
[Raw transfer]




FMN_A_3(4GCZ)
FIXL_BRADU
[Raw transfer]




RBF_B_6(4R38)
LVHK2_ERYLH
[Raw transfer]




RBF_A_5(4R38)
LVHK2_ERYLH
[Raw transfer]




FMN_B_4(4WF0)
?
[Raw transfer]




RBF_A_5(4R3A)
LVHK2_ERYLH
[Raw transfer]




FMN_A_4(2PR5)
PHOT_BACSU
[Raw transfer]




FMN_H_8(1G28)
?
[Raw transfer]




FMN_A_3(5DKK)
?
[Raw transfer]




FMN_B_3(4EET)
PHOT2_ARATH
[Raw transfer]




FMN_B_6(1JNU)
?
[Raw transfer]




FMN_D_8(1JNU)
?
[Raw transfer]




FMN_C_7(1JNU)
?
[Raw transfer]




FMN_C_10(3ULF)
?
[Raw transfer]




FMN_B_8(3ULF)
?
[Raw transfer]




FMN_E_12(3UE6)
?
[Raw transfer]




FMN_A_5(1JNU)
?
[Raw transfer]




FMN_A_2(4EES)

[Raw transfer]




FMN_D_4(4EET)

[Raw transfer]




FMN_B_4(2Z6D)
PHOT2_ARATH
[Raw transfer]




FMN_A_2(4EEU)

[Raw transfer]




FMN_A_3(2Z6D)
PHOT2_ARATH
[Raw transfer]




FMN_G_7(1G28)
?
[Raw transfer]




FMN_A_3(3T50)
LOVHK_BRUME
[Raw transfer]




FMN_E_5(1G28)
?
[Raw transfer]




FMN_B_3(4EET)
PHOT2_ARATH
[Raw transfer]




FMN_F_6(1G28)
?
[Raw transfer]




FMN_A_7(3UE6)
?
[Raw transfer]




FMN_A_2(2V0U)
?
[Raw transfer]




FMN_A_3(2Z6D)
PHOT2_ARATH
[Raw transfer]




FMN_F_13(3UE6)
?
[Raw transfer]




FMN_A_3(2Z6C)
PHOT1_ARATH
[Raw transfer]




FMN_A_5(5A8B)
?
[Raw transfer]




FMN_C_10(3UE6)
?
[Raw transfer]




FMN_B_4(2Z6C)

[Raw transfer]




FMN_A_7(3ULF)
?
[Raw transfer]




FMN_B_8(3UE6)
?
[Raw transfer]




FMN_E_12(3ULF)
?
[Raw transfer]




FMN_A_2(4EER)

[Raw transfer]




FMN_A_2(4EEP)

[Raw transfer]




FMN_D_11(3UE6)
?
[Raw transfer]




FMN_E_5(1G28)
?
[Raw transfer]




FMN_F_13(3ULF)
?
[Raw transfer]




FMN_D_11(3ULF)
?
[Raw transfer]




FMN_C_8(5A8B)
?
[Raw transfer]




1 PsiBlast_PDB 83.1986% -74 - C2 -4GCZ - FIXL_BRADU (first) -
101 HHSearch 82.6693% -74 - C2 -4GCZ 10.3 FIXL_BRADU (first)
23 PsiBlast_CBE 79.3386% -65 - C2 -4GCZ - PHOT_BACSU -
3 PsiBlast_PDB 79.07100% -66 - C2 -2PR6 - PHOT_BACSU -
21 PsiBlast_CBE 78.56100% -63 - C2 -2PR6 - PHOT_BACSU -
2 PsiBlast_PDB 78.11100% -63 - C2 -2PR5 - PHOT_BACSU -
22 PsiBlast_CBE 77.17100% -61 - C2 -2PR5 - PHOT_BACSU -
105 HHSearch 77.1399% -63 - C2 -2PR5 11.0 PHOT_BACSU
8 PsiBlast_PDB 65.4149% -81 - C2 -2WKP - RAC1_HUMAN -
9 PsiBlast_PDB 65.3745%-106 - C2 -5DKK - ? -
25 PsiBlast_CBE 65.0745%-104 - C2 -5DKK - ? -
27 PsiBlast_CBE 64.7546% -93 - C2 -5A8B - ? -
19 PsiBlast_PDB 64.5748% -78 - C2 -2WKR - RAC1_HUMAN -
39 PsiBlast_CBE 64.0243% -74 - C2 -3ULF 6.1 ?
35 PsiBlast_CBE 63.8743% -84 - C2 -3ULF 5.1 ?
47 PsiBlast_CBE 63.7742% -72 - C2 -2Z6C 9.7
41 PsiBlast_CBE 63.7043% -83 - C2 -3UE6 8.7 ?
15 PsiBlast_PDB 63.5146% -87 - C2 -5A8B - ? -
102 HHSearch 63.4440% -71 - C2 -2Z6D 9.7 PHOT2_ARATH
6 PsiBlast_PDB 63.4349% -68 - C2 -2V1A - ? -
32 PsiBlast_CBE 63.4139% -79 - C2 -4R38 9.6 LVHK2_ERYLH
106 HHSearch 63.1445% -84 - C2 -5DKK 9.1 ?
46 PsiBlast_CBE 63.0843% -82 - C2 -3UE6 7.8 ?
40 PsiBlast_CBE 62.9643% -87 - C2 -3ULF 4.7 ?
43 PsiBlast_CBE 62.5443% -84 - C2 -3UE6 7.3 ?
36 PsiBlast_CBE 61.9343% -84 - C2 -3ULF 5.9 ?
29 PsiBlast_CBE 61.8346% -91 - C2 -5A8B 2.8 ?
45 PsiBlast_CBE 61.6743% -72 - C2 -3UE6 8.3 ?
42 PsiBlast_CBE 61.0243% -77 - C2 -3UE6 8.2 ?
30 PsiBlast_CBE 61.0249% -71 - C2 -4WF0 9.0 ?
103 HHSearch 60.9946% -55 - C2 -2V0U 9.9 ?
44 PsiBlast_CBE 60.7443% -82 - C2 -3UE6 7.1 ?
65 PsiBlast_CBE 60.4640% -71 - C2 -2Z6D 9.7 PHOT2_ARATH
108 HHSearch 59.9643% -87 - C2 -3T50 9.5 LOVHK_BRUME
31 PsiBlast_CBE 59.9439% -77 - C2 -4R38 9.1 LVHK2_ERYLH
110 HHSearch 59.3246% -74 - C2 -4EET 10.1 PHOT2_ARATH
112 HHSearch 59.0338% -53 - C2 -4R3A 8.7 LVHK2_ERYLH
37 PsiBlast_CBE 58.5843% -72 - C2 -3ULF 3.7 ?
57 PsiBlast_CBE 58.5647%-110 - C2 -1JNU 6.1 ?
109 HHSearch 58.4842% -74 - C2 -4R38 9.3 LVHK2_ERYLH
66 PsiBlast_CBE 58.4143% -69 - C2 -4EEU 10.0
38 PsiBlast_CBE 57.8743% -76 - C2 -3ULF 3.5 ?
51 PsiBlast_CBE 57.3949% -95 - C2 -4EET 10.1 PHOT2_ARATH
56 PsiBlast_CBE 56.8747%-108 - C2 -1JNU 5.9 ?
59 PsiBlast_CBE 56.6747%-109 - C2 -1JNU 6.8 ?
52 PsiBlast_CBE 56.3449% -85 - C2 -4EES 10.0
49 PsiBlast_CBE 56.2648% -90 - C2 -4EEP 9.7
33 PsiBlast_CBE 56.1539% -75 - C2 -4R38 8.9 LVHK2_ERYLH
58 PsiBlast_CBE 56.0947%-106 - C2 -1JNU 5.9 ?
48 PsiBlast_CBE 55.8842% -51 - C2 -2Z6C 10.1 PHOT1_ARATH
50 PsiBlast_CBE 55.7749% -85 - C2 -4EET 10.2
64 PsiBlast_CBE 55.5940% -58 - C2 -2Z6D 8.4 PHOT2_ARATH
63 PsiBlast_CBE 55.4947% -96 - C2 -1G28 8.5 ?
60 PsiBlast_CBE 54.9647% -97 - C2 -1G28 8.5 ?
61 PsiBlast_CBE 54.8147%-101 - C2 -1G28 8.4 ?
53 PsiBlast_CBE 54.7947% -86 - C2 -4EER 9.9
62 PsiBlast_CBE 54.7647%-100 - C2 -1G28 8.5 ?
115 HHSearch 52.1541% 26 - C2 -5A8B 8.4 ?
122 Fugue 49.7945% 7 * C2 *1G28 7.1 ?