@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu35580: (2016-07-30 )
MKKIAVIGTGYVGLVSGTCFAEIGNKVVCCDIDESKIRSLKNGVIPIYEPGLADLVEKNVLDQRLTFTNDIPSAIRASDIIYIAVGTPMSKTGEADLTYVKAAAKTIGEHLNGYKVIVNKSTVPVGTGKLVQSIVQKASKGRYSFDVVSNPEFLREGSAIHDTMNMERAVIGSTSHKAAAIIEELHQPFHAPVIKTNLESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADGVGLDSRIGRKFLKAGIGFGGSCFPKDTTALLQIAKSAGYPFKLIEAVIETNEKQRVHIVDKLLTVMGSVKGRTISVLGLAFKPNTNDVRSAPALDIIPMLQQLGAHVKAYDPIAIPEASAILGEQVEYYTDVYAAMEDTDACLILTDWPEVKEMELVKVKTLLKQPVIIDGRNLFSLEEMQAAGYIYHSIGRPAVRGTEPSDKYFPGLPLEELAKDLGSVNL

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_A_5(1DLJ)
UDG_STRPY
[Raw transfer]




NAD_A_3(4A7P)
?
[Raw transfer]




NAD_A_3(4XR9)
?
[Raw transfer]




UPG_A_2(3VTF)
?
[Raw transfer]




2 PsiBlast_PDB 97.0048% 0 - C- -3GG2 - ? -
21 PsiBlast_CBE 96.0348% 0 - C- -3GG2 - ? -
25 PsiBlast_CBE 83.0944% -36 - C3 -2Y0C - ? -
5 PsiBlast_PDB 82.9344% -33 - C3 -2Y0D - ? -
3 PsiBlast_PDB 82.8044% -32 - C3 -2Y0E - ? -
28 PsiBlast_CBE 82.7844% -35 - C3 -2Y0D - ? -
22 PsiBlast_CBE 82.3544% -34 - C3 -2Y0E - ? -
30 PsiBlast_CBE 82.2144% -38 - C3 -2Y0D - ? -
4 PsiBlast_PDB 82.1644% -28 - C3 -2Y0C - ? -
23 PsiBlast_CBE 82.1444% -34 - C3 -2Y0E - ? -
26 PsiBlast_CBE 81.9544% -36 - C3 -2Y0C - ? -
24 PsiBlast_CBE 81.8944% -35 - C3 -2Y0E - ? -
27 PsiBlast_CBE 81.8644% -35 - C3 -2Y0C - ? -
29 PsiBlast_CBE 81.8544% -34 - C3 -2Y0D - ? -
112 HHSearch 81.1345% -27 - C3 -2Y0C - ? -
118 HHSearch 80.7347% -40 - C3 -3GG2 - ? -
16 PsiBlast_PDB 76.4535% -30 - C3 -3ITK - UGDH_HUMAN -
84 PsiBlast_CBE 76.3035% -27 - C3 -3ITK - UGDH_HUMAN -
83 PsiBlast_CBE 76.2735% -26 - C3 -3ITK - UGDH_HUMAN -
1 PsiBlast_PDB 76.1148% -11 - C3 -4A7P - ? -
113 HHSearch 75.9348% -17 - C3 -4A7P 9.1 ?
116 HHSearch 74.3839% -49 - C3 -3VTF 7.5 ?