@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu37500: (2016-08-02 )
MSELWYTEKQTKNFGITMKVNKTLHTEQTEFQHLEMVETEEFGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSIAGKLDDPRVDVQVDDGFMHIAKSENQYDVIMVDSTEPVGPAVNLFTKGFYAGIAKALKEDGIFVAQTDNPWFTPELITNVQRDVKEIFPITKLYTANIPTYPSGLWTFTIGSKKYDPLAVEDSRFFDIETKYYTKDIHKAAFVLPKFVSDLIK

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AAT_C_6(2I7C)
?
[Raw transfer]




AAT_A_4(2I7C)
?
[Raw transfer]




AAT_B_5(2I7C)
?
[Raw transfer]




AAT_A_4(2I7C)
?
[Raw transfer]




JFQ_A_5(3RIE)
?
[Raw transfer]




AG3_C_10(2E5W)
SPEE_PYRHO
[Raw transfer]




AG3_A_9(2E5W)
SPEE_PYRHO
[Raw transfer]




JFQ_B_8(3RIE)
?
[Raw transfer]




JA2_A_4(4CWA)
?
[Raw transfer]




JA2_C_6(4CWA)
?
[Raw transfer]




S4M_B_7(4BP3)
?
[Raw transfer]




S4M_C_10(4BP3)
?
[Raw transfer]




S4M_B_5(4YUW)
?
[Raw transfer]




S4M_B_4(4YUV)
?
[Raw transfer]




SPD_C_6(2PWP)
?
[Raw transfer]




S4M_A_5(4BP3)
?
[Raw transfer]




SPD_A_4(2PWP)
?
[Raw transfer]




SPD_B_5(2PWP)
?
[Raw transfer]




S4M_B_5(4YUX)
?
[Raw transfer]




4ZY_B_7(4UOE)
?
[Raw transfer]




S4M_B_5(4YUY)
?
[Raw transfer]




S4M_A_3(4YUY)
?
[Raw transfer]




4ZY_C_11(4UOE)
?
[Raw transfer]




S4M_A_4(2PT6)
?
[Raw transfer]




4MN_C_9(4BP3)
?
[Raw transfer]




4MN_B_6(4BP3)
?
[Raw transfer]




MTA_B_6(4UOE)
?
[Raw transfer]




MTA_A_7(3B7P)
?
[Raw transfer]




MTA_B_6(4BP1)
?
[Raw transfer]




MTA_C_9(4BP1)
?
[Raw transfer]




1SQ_B_6(4YUY)
?
[Raw transfer]




MTA_B_6(4CXM)
?
[Raw transfer]




MTA_B_8(3B7P)
?
[Raw transfer]




MTA_A_4(4BP1)
?
[Raw transfer]




MTA_C_11(2HTE)
?
[Raw transfer]




MTA_A_4(4CXM)
?
[Raw transfer]




MTA_C_9(3B7P)
?
[Raw transfer]




MTA_C_8(4CXM)
?
[Raw transfer]




MTA_C_10(4UOE)
?
[Raw transfer]




MTA_C_11(3RIE)
?
[Raw transfer]




MTA_A_4(4UOE)
?
[Raw transfer]




MTA_C_12(2E5W)
SPEE_PYRHO
[Raw transfer]




MTA_A_4(3RIE)
?
[Raw transfer]




MTA_B_9(2HTE)
?
[Raw transfer]




MTA_A_11(2E5W)
SPEE_PYRHO
[Raw transfer]




MTA_B_7(3RIE)
?
[Raw transfer]




MTA_A_7(2HTE)
?
[Raw transfer]




MTA_A_5(2O07)
SPEE_HUMAN
[Raw transfer]




MTA_B_4(3ANX)
SPEE_THET8
[Raw transfer]




MTA_A_3(3ANX)
SPEE_THET8
[Raw transfer]




105 HHSearch 95.07100% -93 - C1 -1IY9 - SPEE_BACSU -
1 PsiBlast_PDB 95.07100% -93 - C1 -1IY9 - SPEE_BACSU -
58 PsiBlast_CBE 71.2839% -92 - C1 -4CXM 6.8 ?
81 PsiBlast_CBE 71.2239% -96 - C1 -2I7C 10.0 ?
67 PsiBlast_CBE 71.1239% -92 - C1 -4BP1 6.7 ?
80 PsiBlast_CBE 71.0639% -92 - C1 -2I7C 9.5 ?
65 PsiBlast_CBE 71.0139% -96 - C1 -4BP3 8.7 ?
64 PsiBlast_CBE 70.9939% -93 - C1 -4BP3 8.6 ?
59 PsiBlast_CBE 70.9839% -95 - C1 -4CXM 6.4 ?
79 PsiBlast_CBE 70.9039% -91 - C1 -2I7C 9.8 ?
85 PsiBlast_CBE 70.8639% -93 - C1 -4UOE 6.6 ?
70 PsiBlast_CBE 70.8239% -89 - C1 -3RIE 6.6 ?
74 PsiBlast_CBE 70.6939% -95 - C1 -3B7P 6.6 ?
61 PsiBlast_CBE 70.6939% -90 - C1 -4CWA 5.5 ?
68 PsiBlast_CBE 70.6839% -94 - C1 -4BP1 6.5 ?
73 PsiBlast_CBE 70.5339% -91 - C1 -3B7P 6.8 ?
71 PsiBlast_CBE 70.4539% -97 - C1 -3RIE 6.4 ?
82 PsiBlast_CBE 70.3839% -89 - C1 -2HTE 6.3 ?
86 PsiBlast_CBE 70.3339% -97 - C1 -4UOE 6.7 ?
66 PsiBlast_CBE 70.2939% -97 - C1 -4BP3 8.6 ?
76 PsiBlast_CBE 70.2039% -88 - C1 -2PWP 3.2 ?
84 PsiBlast_CBE 70.1639%-100 - C1 -2HTE 5.2 ?
83 PsiBlast_CBE 70.1539%-100 - C1 -2HTE 5.7 ?
60 PsiBlast_CBE 69.6839% -92 - C1 -4CXM 6.7 ?
75 PsiBlast_CBE 69.6439% -93 - C1 -3B7P 6.6 ?
69 PsiBlast_CBE 69.6439% -91 - C1 -4BP1 6.5 ?
72 PsiBlast_CBE 69.5639% -91 - C1 -3RIE 6.6 ?
78 PsiBlast_CBE 69.5439% -90 - C1 -2PWP 2.7 ?
63 PsiBlast_CBE 69.5439% -90 - C1 -4CWA 5.6 ?
87 PsiBlast_CBE 69.1339% -90 - C1 -4UOE 6.6 ?
77 PsiBlast_CBE 69.1339% -96 - C1 -2PWP 3.3 ?
94 PsiBlast_CBE 61.3635% -36 - C1 -2E5W 6.5 SPEE_PYRHO
96 PsiBlast_CBE 60.3435% -34 - C1 -2E5W 6.8 SPEE_PYRHO
89 PsiBlast_CBE 59.9033% -38 - C1 -3ANX 4.0 SPEE_THET8
40 PsiBlast_CBE 59.8639% 32 - C1 -4YUW 7.8 ?
41 PsiBlast_CBE 59.5139% 32 - C1 -4YUV 7.5 ?
39 PsiBlast_CBE 59.4539% 31 - C1 -4YUX 8.0 ?
38 PsiBlast_CBE 59.3739% 33 - C1 -4YUY 7.9 ?
110 HHSearch 58.3540% 35 - C1 -4YUY 8.1 ?
88 PsiBlast_CBE 58.3333% -35 - C1 -3ANX 4.5 SPEE_THET8
100 HHSearch 56.0638% 38 - C1 -2I7C 9.4 ?
102 HHSearch 55.9338% 31 - C1 -2O07 5.2 SPEE_HUMAN
107 HHSearch 54.8538% 36 * C1 *2PT6 7.8 ?