@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu39070: (2016-08-05 )
MPYLKRVLLLLVTGLFMSLFAVTATASAQTGGSFFDPFNGYNSGFWQKADGYSNGNMFNCTWRANNVSMTSLGEMRLALTSPAYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFFTYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKIVDLGFDAANAYHTYAFDWQPNSIKWYVDGQLKHTATNQIPTTPGKIMMNLWNGTGVDEWLGSYNGVNPLYAHYDWVRYTKK

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUGAR_B_6(1U0A)
GUB_PAEMA
[Raw transfer]

-

SUGAR_D_8(1U0A)
GUB_PAEMA
[Raw transfer]

-

SUGAR_A_5(1U0A)
GUB_PAEMA
[Raw transfer]

-

SUGAR_C_7(1U0A)
GUB_PAEMA
[Raw transfer]

-

TRS_A_5(3H0O)
GUB_FIBSS
[Raw transfer]




B3P_A_3(3O5S)
GUB_BACSU
[Raw transfer]




B3P_A_3(3O5S)
GUB_BACSU
[Raw transfer]




EPE_A_6(1AJK)
GUB_PAEMA
[Raw transfer]




TRS_A_3(3AXD)
GUB_FIBSS
[Raw transfer]




SUGAR_A_2(1BYH)
GUB_PAEMA
[Raw transfer]

-

TRS_A_5(3HR9)
GUB_FIBSS
[Raw transfer]




B3P_B_6(3WVJ)
GUB_CLOTH
[Raw transfer]




B3P_A_4(3WVJ)
GUB_CLOTH
[Raw transfer]




B3P_A_4(3WVJ)
GUB_CLOTH
[Raw transfer]




NBU_A_4(1BYH)
GUB_PAEMA
[Raw transfer]




1 PsiBlast_PDB 94.0899% -60 - C2 -3O5S 2.5 GUB_BACSU
41 HHSearch 93.8698% -60 - C2 -3O5S 2.5 GUB_BACSU
2 PsiBlast_PDB 91.4591% -59 - C2 -1GBG - GUB_BACLI -
4 PsiBlast_PDB 86.7579% -65 - C2 -1GLH - GUB_PAEMA -
23 PsiBlast_CBE 86.6278% -68 - C2 -1U0A 6.2 GUB_PAEMA
5 PsiBlast_PDB 86.6179% -66 - C2 -2AYH - GUB_PAEMA -
42 HHSearch 86.6079% -63 * C2 *2AYH - GUB_PAEMA -
21 PsiBlast_CBE 86.4678% -68 - C2 -1U0A 6.3 GUB_PAEMA
22 PsiBlast_CBE 85.6178% -71 - C2 -1U0A 6.3 GUB_PAEMA
6 PsiBlast_PDB 85.5178% -68 - C2 -1U0A 6.4 GUB_PAEMA
8 PsiBlast_PDB 85.4475% -72 - C2 -1MAC - GUB_PAEMA -
25 PsiBlast_CBE 85.3775% -71 - C2 -1MAC - GUB_PAEMA -
3 PsiBlast_PDB 84.2479% -62 - C2 -1BYH 3.0 GUB_PAEMA
24 PsiBlast_CBE 77.2279% -43 - C2 -3D6E - GUB_BACLI -
7 PsiBlast_PDB 76.0479% -42 - C2 -3D6E - GUB_BACLI -
26 PsiBlast_CBE 75.8581% -74 - C2 -1AXK - GUB_PAEMA (first) -
9 PsiBlast_PDB 75.5281% -78 - C2 -1AXK - GUB_PAEMA (first) -
10 PsiBlast_PDB 74.5281% -79 - C2 -1CPM - GUB_PAEMA -
11 PsiBlast_PDB 73.5581% -75 - C2 -1CPN - GUB_PAEMA -
12 PsiBlast_PDB 69.6660% 9 - C2 -3I4I - ? -
44 HHSearch 68.9255% -11 - C2 -3WVJ 3.0 GUB_CLOTH
28 PsiBlast_CBE 68.4555% -15 - C2 -3WVJ 2.9 GUB_CLOTH
13 PsiBlast_PDB 68.2755% -15 - C2 -3WVJ 3.0 GUB_CLOTH
14 PsiBlast_PDB 63.9182% -85 - C2 -1AJK 2.5 GUB_PAEMA
16 PsiBlast_PDB 43.1236% 18 - C2 -3AXD 2.9 GUB_FIBSS
20 PsiBlast_PDB 41.9435% 18 - C2 -3HR9 2.3 GUB_FIBSS
18 PsiBlast_PDB 41.0135% 18 - C2 -3H0O 2.9 GUB_FIBSS