@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu39420: (2016-08-05 )
MSLANIIDHTALKPHTQKADILKLIEEAKTYKFASVCVNPTWVELAAKELKGTGVDVCTVIGFPLGANTTETKAFETKDAISKGATEVDMVINIAALKDKEDDVVEADIRGVVEAVAGKALVKVIIETCLLTDEEKERACRLAVSAGADFVKTSTGFSTGGATKEDIALMRKTVGPDIGVKASGGVRTKEDVDTMVEAGASRIGASAGVSIVKGENASGGDNY

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HPD_A_5(1UB3)
DEOC_THET8
[Raw transfer]




HPD_B_6(1UB3)
DEOC_THET8
[Raw transfer]




HPD_A_5(1UB3)
DEOC_THET8
[Raw transfer]




HPD_D_8(1UB3)
DEOC_THET8
[Raw transfer]




HPD_C_7(1UB3)
DEOC_THET8
[Raw transfer]




CIT_A_3(3R12)
DEOC_THEMA
[Raw transfer]




CIT_A_3(3R12)
DEOC_THEMA
[Raw transfer]




GOL_A_7(3R13)
DEOC_THEMA
[Raw transfer]




HPD_B_4(1JCL)
DEOC_ECOLI
[Raw transfer]




HPD_A_3(1JCL)
DEOC_ECOLI
[Raw transfer]




HPD_A_3(1JCJ)
DEOC_ECOLI
[Raw transfer]




ACY_B_3(4XBK)
?
[Raw transfer]




HPD_B_4(1JCJ)
DEOC_ECOLI
[Raw transfer]




UNL_A_4(3NDO)
?
[Raw transfer]




UNL_B_7(3NG3)
DEOC_MYCA1
[Raw transfer]




UNL_B_7(3NDO)
?
[Raw transfer]




UNL_D_12(3NG3)
DEOC_MYCA1
[Raw transfer]




UNL_C_9(3NG3)
DEOC_MYCA1
[Raw transfer]




UNL_A_4(3NDO)
?
[Raw transfer]




UNL_A_6(3NG3)
DEOC_MYCA1
[Raw transfer]




UNL_A_5(5C5Y)
?
[Raw transfer]




UNL_D_11(5C5Y)
?
[Raw transfer]




UNL_A_5(5C5Y)
?
[Raw transfer]




UNL_C_10(5C5Y)
?
[Raw transfer]




ACY_B_4(4XBK)
?
[Raw transfer]




UNL_B_8(5C5Y)
?
[Raw transfer]




UNL_A_3(5C2X)
?
[Raw transfer]




UNL_B_5(5C2X)
?
[Raw transfer]




23 PsiBlast_CBE 90.4961%-113 - C2 -3NGJ - ? -
21 PsiBlast_CBE 89.3561%-111 - C2 -3NGJ - ? -
22 PsiBlast_CBE 89.2061%-107 - C2 -3NGJ - ? -
1 PsiBlast_PDB 89.0061%-109 - C2 -3NGJ - ? -
107 HHSearch 88.8860%-111 * C2 *3NGJ - ? -
5 PsiBlast_PDB 86.8757% -94 - C2 -3R13 1.9 DEOC_THEMA
104 HHSearch 86.7756% -98 - C2 -3R12 3.0 DEOC_THEMA
4 PsiBlast_PDB 86.4757% -95 - C2 -3R12 3.0 DEOC_THEMA
25 PsiBlast_CBE 82.9948% -78 - C2 -3OA3 - ? -
6 PsiBlast_PDB 81.8948% -78 - C2 -3OA3 - ? -
105 HHSearch 80.0348% -78 - C2 -3OA3 - ? -
106 HHSearch 79.3743% -97 - C2 -1UB3 3.8 DEOC_THET8
7 PsiBlast_PDB 79.0042% -97 - C2 -1J2W - DEOC_THET8 -
8 PsiBlast_PDB 78.9242% -97 - C2 -1UB3 3.8 DEOC_THET8
26 PsiBlast_CBE 78.4242%-102 - C2 -1UB3 4.1 DEOC_THET8
28 PsiBlast_CBE 77.7542%-103 - C2 -1UB3 3.6 DEOC_THET8
3 PsiBlast_PDB 77.7251% -48 - C2 -4XBK - ? -
27 PsiBlast_CBE 77.2742%-100 - C2 -1UB3 4.0 DEOC_THET8
111 HHSearch 76.7442%-102 - C2 -1MZH - DEOC_AQUAE -
24 PsiBlast_CBE 76.2351% -51 - C2 -4XBK 3.4 ?
30 PsiBlast_CBE 72.9242% -66 - C2 -3NDO 2.9 ?
10 PsiBlast_PDB 71.7342% -67 - C2 -3NDO 2.9 ?
108 HHSearch 70.7943% -69 - C2 -3NDO 2.9 ?
32 PsiBlast_CBE 69.9745% -69 - C2 -3NG3 3.3 DEOC_MYCA1
31 PsiBlast_CBE 69.8145% -68 - C2 -3NG3 3.3 DEOC_MYCA1
33 PsiBlast_CBE 69.3845% -63 - C2 -3NG3 2.9 DEOC_MYCA1
11 PsiBlast_PDB 68.2145% -62 - C2 -3NG3 2.9 DEOC_MYCA1
102 HHSearch 60.6032% 13 - C2 -5C5Y 3.0 ?
37 PsiBlast_CBE 59.4534% 21 - C2 -5C2X 2.0 ?
35 PsiBlast_CBE 59.0434% 22 - C2 -5C5Y 2.7 ?
34 PsiBlast_CBE 58.9234% 24 - C2 -5C5Y 2.9 ?
13 PsiBlast_PDB 58.7734% 23 - C2 -5C2X 1.9 ?
20 PsiBlast_PDB 58.6033% 1 - C2 -1JCJ 3.1 DEOC_ECOLI
41 PsiBlast_CBE 58.4933% 1 - C2 -1JCL 2.1 DEOC_ECOLI
36 PsiBlast_CBE 58.4234% 23 - C2 -5C5Y 3.0 ?
42 PsiBlast_CBE 58.1433% 0 - C2 -1JCJ 2.4 DEOC_ECOLI
16 PsiBlast_PDB 57.9733% 3 - C2 -1JCL 1.9 DEOC_ECOLI
14 PsiBlast_PDB 57.7434% 24 - C2 -5C5Y 2.9 ?