@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1872c: (2016-05-05 )
MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGGAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRVAAAGFDTMLVTVDVPVAGARLRDVRNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSNHGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FNS_E_5(1QCW)
CYB2_YEAST
[Raw transfer]




FNS_G_7(1QCW)
CYB2_YEAST
[Raw transfer]




GLV_A_3(2RDU)
HAOX1_HUMAN
[Raw transfer]




173_I_9(1SZE)
CYB2_YEAST
[Raw transfer]




173_K_11(1SZE)
CYB2_YEAST
[Raw transfer]




FMN_E_5(2A7N)
GOX_SPIOL
[Raw transfer]




FMN_E_5(1SZE)
CYB2_YEAST
[Raw transfer]




FMN_I_9(1P5B)
GOX_SPIOL
[Raw transfer]




FMN_A_2(3GIY)
MDLB_PSEPU
[Raw transfer]




FMN_A_4(1LCO)
CYB2_YEAST
[Raw transfer]




FMN_I_9(1P4C)
GOX_SPIOL
[Raw transfer]




FMN_B_6(1LCO)
CYB2_YEAST
[Raw transfer]




FMN_E_5(2A85)
GOX_SPIOL
[Raw transfer]




FMN_E_5(2A7P)
GOX_SPIOL
[Raw transfer]




FMN_G_7(1SZF)
CYB2_YEAST
[Raw transfer]




FMN_G_7(1SZE)
CYB2_YEAST
[Raw transfer]




FMN_I_9(1P4C)
GOX_SPIOL
[Raw transfer]




FMN_B_5(1FCB)
CYB2_YEAST
[Raw transfer]




FMN_E_5(1SZF)
CYB2_YEAST
[Raw transfer]




EDO_B_6(1KBJ)
CYB2_YEAST
[Raw transfer]




FMN_F_6(1HUV)
GOX_SPIOL
[Raw transfer]




FMN_B_6(1KBI)
CYB2_YEAST
[Raw transfer]




FMN_B_6(1LDC)
CYB2_YEAST
[Raw transfer]




FMN_B_5(1KBJ)
CYB2_YEAST
[Raw transfer]




FMN_A_3(1KBJ)
CYB2_YEAST
[Raw transfer]




3IL_M_13(2A7P)
GOX_SPIOL
[Raw transfer]




FMN_B_5(2OZ0)
CYB2_YEAST
[Raw transfer]




EDO_A_4(1KBJ)
CYB2_YEAST
[Raw transfer]




LAC_A_4(2NLI)
?
[Raw transfer]




HEM_A_4(1KBI)
CYB2_YEAST
[Raw transfer]




HEM_A_4(1KBI)
CYB2_YEAST
[Raw transfer]




HEM_A_3(1FCB)
CYB2_YEAST
[Raw transfer]




HEM_A_4(1LDC)
CYB2_YEAST
[Raw transfer]




HEM_A_3(2OZ0)
CYB2_YEAST
[Raw transfer]




54 HHSearch 95.8636%-107 - C5 -1GOX - GOX_SPIOL -
14 PsiBlast_PDB 94.8935%-110 - C5 -1GOX - GOX_SPIOL -
52 HHSearch 94.8538%-107 - C5 -1P4C 9.6 GOX_SPIOL
5 PsiBlast_PDB 93.9436%-111 - C5 -2A7P 9.6 GOX_SPIOL (first)
7 PsiBlast_PDB 93.8036%-109 - C5 -3GIY 9.8 MDLB_PSEPU
2 PsiBlast_PDB 93.7037%-107 - C5 -1P4C 9.6 GOX_SPIOL
3 PsiBlast_PDB 93.4737%-108 - C5 -1P5B 9.9 GOX_SPIOL (first)
4 PsiBlast_PDB 93.4636%-110 - C5 -2A7N 9.9 GOX_SPIOL
6 PsiBlast_PDB 93.3436%-108 - C5 -2A85 9.1 GOX_SPIOL
13 PsiBlast_PDB 93.0235%-116 - C5 -1AL8 - GOX_SPIOL -
12 PsiBlast_PDB 92.6035%-106 - C5 -1AL7 - GOX_SPIOL -
1 PsiBlast_PDB 92.4237%-113 - C5 -1HUV 8.7 GOX_SPIOL (first)
11 PsiBlast_PDB 91.8333%-110 - C5 -2RDW - HAOX1_HUMAN -
10 PsiBlast_PDB 91.4433%-109 - C5 -2RDU 2.8 HAOX1_HUMAN
53 HHSearch 88.3634%-105 * C5 *3SGZ - HAOX2_RAT -
55 HHSearch 88.1333%-100 - C5 -1KBI 3.2 CYB2_YEAST
25 PsiBlast_CBE 87.8032%-106 - C5 -1TB3 - HAOX2_RAT -
30 PsiBlast_CBE 87.6832%-106 - C5 -1TB3 - HAOX2_RAT -
28 PsiBlast_CBE 87.5432%-107 - C5 -1TB3 - HAOX2_RAT -
29 PsiBlast_CBE 87.4032%-105 - C5 -1TB3 - HAOX2_RAT -
35 PsiBlast_CBE 87.0831%-107 - C5 -1SZF 10.0 CYB2_YEAST
50 PsiBlast_CBE 86.4631%-111 - C5 -1QCW 9.9 CYB2_YEAST
46 PsiBlast_CBE 86.3631%-106 - C5 -1SZE 9.1 CYB2_YEAST
37 PsiBlast_CBE 85.9431%-110 - C5 -1KBI 3.2 CYB2_YEAST
49 PsiBlast_CBE 85.8831%-110 - C5 -1QCW 9.9 CYB2_YEAST
38 PsiBlast_CBE 85.6731%-106 - C5 -1FCB 9.0 CYB2_YEAST
36 PsiBlast_CBE 85.4831%-108 - C5 -1KBI 9.8 CYB2_YEAST
44 PsiBlast_CBE 84.9931%-107 - C5 -1LCO 9.7 CYB2_YEAST
42 PsiBlast_CBE 84.8231%-106 - C5 -1LDC 4.8 CYB2_YEAST
33 PsiBlast_CBE 84.6131%-107 - C5 -1KBJ 10.3 CYB2_YEAST
20 PsiBlast_PDB 84.2831%-107 - C5 -1FCB 3.9 CYB2_YEAST
43 PsiBlast_CBE 84.1931%-103 - C5 -1LCO 9.8 CYB2_YEAST
18 PsiBlast_PDB 83.8031%-106 - C5 -1SZF 9.7 CYB2_YEAST
45 PsiBlast_CBE 83.5431%-103 - C5 -1SZE 7.9 CYB2_YEAST
17 PsiBlast_PDB 83.2531%-107 - C5 -1KBJ 10.3 CYB2_YEAST
41 PsiBlast_CBE 82.5131%-102 - C5 -1LDC 9.0 CYB2_YEAST
48 PsiBlast_CBE 82.3831%-105 - C5 -2OZ0 1.6 CYB2_YEAST
47 PsiBlast_CBE 80.4831%-106 - C5 -2OZ0 5.6 CYB2_YEAST