@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0018: (2015-12-18 )
MSQALRIVFAGTPEFAAEHLKALLDTPHRIVAVYTQPDRPAGRGQKLMPSAVKSLALEHGLPVMQPQSLRNAEAQAELAALRADLMVVVAYGLILPQAVLDIPRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMQMEAGLDTGPMLLKVSTPISAADTGGSLHDRLAALGPKAVIEAIAGLAAGTLHGEIQDDALATYAHKLNKDEARLDWSRPAVELERQVRAFTPWPVCHTSLADAPLKVLGASLGQGSGAPGTILEASRDGLLVACGEGALRLTRLQLPGGKPLAFADLYNSRREQFAAGQVLGQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_4(3Q0I)
FMT_VIBCH
[Raw transfer]




GOL_A_4(3Q0I)
FMT_VIBCH
[Raw transfer]




GOL_A_6(3R8X)
FMT_YERPE
[Raw transfer]




EDO_B_17(4LXU)
?
[Raw transfer]




MET_A_2(3R8X)
FMT_YERPE
[Raw transfer]




FME_D_8(2FMT)
FMT_ECOLI
[Raw transfer]




FME_C_6(2FMT)
FMT_ECOLI
[Raw transfer]




28 HHSearch 92.4061%-116 - C5 -1FMT - FMT_ECOLI -
1 PsiBlast_PDB 92.3760%-117 - C5 -1FMT - FMT_ECOLI -
3 PsiBlast_PDB 91.9357%-116 - C5 -3R8X 3.4 FMT_YERPE
21 PsiBlast_CBE 91.8960%-111 - C5 -2FMT 2.5 FMT_ECOLI
26 HHSearch 91.8356%-121 - C5 -3Q0I 2.2 FMT_VIBCH
2 PsiBlast_PDB 91.2560%-110 - C5 -2FMT 2.6 FMT_ECOLI
4 PsiBlast_PDB 91.0454%-121 - C5 -3Q0I 2.2 FMT_VIBCH
27 HHSearch 88.7550%-123 - C5 -3TQQ - FMT_COXBU -
5 PsiBlast_PDB 88.1948%-124 - C5 -3TQQ - FMT_COXBU -
6 PsiBlast_PDB 76.1036%-107 - C5 -4IQF - FMT_BACAN -
46 Fugue 73.2229%-106 - C5 -1S3I - AL1L1_RAT -
30 HHSearch 72.9527%-104 - C5 -2BW0 - AL1L1_HUMAN -
29 HHSearch 72.6926%-110 * C5 *2BLN - ARNA_ECOLI -
15 PsiBlast_PDB 71.7428%-104 - C5 -1S3I - AL1L1_RAT -
16 PsiBlast_PDB 71.7227%-104 - C5 -2BW0 - AL1L1_HUMAN -
11 PsiBlast_PDB 71.3530%-103 - C5 -4R8V - ? -
17 PsiBlast_PDB 71.2927%-102 - C5 -2CFI - AL1L1_HUMAN -
10 PsiBlast_PDB 71.1430%-102 - C5 -4QPD - ? -
12 PsiBlast_PDB 70.5830%-102 - C5 -4TT8 - ? -
14 PsiBlast_PDB 69.9529%-100 - C5 -4TTS - ? -