@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4853: (2016-03-02 )
MTTETLVSGTTPVSDNANLKQHLTTPTQEGQTLRDSVEKALHNYFAHLEGQPVTDVYNMVLCEVEAPLLETVMNHVKGNQTKASELLGLNRGTLRKKLKQYDLL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_C_3(1FIP)
FIS_ECOLI
[Raw transfer]

-

CHAIN_D_4(1FIP)
FIS_ECOLI
[Raw transfer]

-

CHAIN_D_4(1FIP)
FIS_ECOLI
[Raw transfer]

-

2 PsiBlast_PDB 93.2161%-118 - C1 -1FIA - FIS_ECOLI -
45 Fugue 90.3558%-117 - C1 -1FIP 3.0 FIS_ECOLI
12 PsiBlast_PDB 89.9861%-112 - C1 -3JRF - FIS_ECOLI -
8 PsiBlast_PDB 89.2961%-119 - C1 -3JRB - FIS_ECOLI -
3 PsiBlast_PDB 89.0661%-116 - C1 -3FIS - FIS_ECOLI -
15 PsiBlast_PDB 88.9561%-122 - C1 -3JRI - FIS_ECOLI -
11 PsiBlast_PDB 88.9161%-134 - C1 -3JRE - FIS_ECOLI -
21 PsiBlast_CBE 88.8260%-124 - C1 -1FIP 3.0 FIS_ECOLI
10 PsiBlast_PDB 88.4561%-128 - C1 -3JRD - FIS_ECOLI -
18 PsiBlast_PDB 88.4061%-122 - C1 -4IHX - ? -
1 PsiBlast_PDB 88.2161%-113 - C1 -1F36 - FIS_ECOLI -
17 PsiBlast_PDB 88.1861%-119 - C1 -4IHW - ? -
22 PsiBlast_CBE 88.0360%-120 - C1 -1FIP 3.0 FIS_ECOLI
19 PsiBlast_PDB 87.9961%-122 - C1 -4IHY - ? -
6 PsiBlast_PDB 87.7561%-122 - C1 -3JR9 - FIS_ECOLI -
5 PsiBlast_PDB 87.4261%-123 - C1 -3IV5 - FIS_ECOLI -
16 PsiBlast_PDB 87.2761%-118 - C1 -4IHV - ? -
14 PsiBlast_PDB 86.9961%-115 - C1 -3JRH - FIS_ECOLI -
13 PsiBlast_PDB 86.9161%-126 - C1 -3JRG - FIS_ECOLI -
9 PsiBlast_PDB 86.3961%-116 - C1 -3JRC - FIS_ECOLI -